Проверка синтетической теории эволюции

Как мы эволюционируем?

Как известно, синтетическая теория эволюции постулирует, что новоообразования в живых организмах возникают вследствие мутаций на уровне ДНК. В результате случайной ошибки какого-либо рода в ДНК появляется новая информация, которая приводит к изменению функции экспрессируемого белка или РНК, что ведет к появлению нового морфологического признака или изменению старого.
Данная проверка носит чисто теоретический характер. Чтобы проверить применимость СТЭ теоретически, необходимо ввести граничные условия. Первое из них – нулевое – отсутствие какой-либо информации на ДНК, то есть её нуклеотидная последовательность носит чисто случайный характер. Генетический код, как таковой, отсутствует. В этом случае, вполне очевидно, что на ДНК нет кода рибосомных РНК, тРНК, аминоацил-тРНК-синтетаз и других компонентов системы транскрипции РНК и трансляции белков. Более того, нет никаких сигналов, означающих область промоторов, начала и конца генов. Процесс считывания невозможен. Система нефункциональна.
Для выхода из создавшегося положения предположим, что компоненты системы считывания информации с ДНК возникли самопроизвольно. В таком случае, информацию об их строении необходимо записать на ДНК, хотя бы для простого воспроизводства системы. Но система записи информации на ДНК отсутствует в принципе. Таким образом, этот путь невозможен.
Вывод: синтетическая теория эволюции не объясняет появления информации на ДНК и, в лучшем случае, может носить лишь частный характер.



  • Алексей Варежкин  20 ноября, 12:03
    Я считаю, что подобные пустые обсуждения совершеннейшая глупость, нельзя из пальца высосать описание работы сложной неизвестной системы. Да и вообще про днк вчера только узнали, ответы на подобные вопросы даются в результате сложной кропотливой дорогостоящей работы, а не в результате пустой болтовни, так что само обсуждение смысла не имеет.
    ОтветитьНравится
  • Александр Вихров  20 ноября, 12:11
    Алексей Варежкин, система прекрасно известна. Если вы не в курсе, так не болтайте.
    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 12:26
    под системой я имею вииду работу днк и ее изменение — и что же интересно там прекрасно известно — вообще одно сплошное белое пятно
    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 18:26
    «Я считаю, что подобные пустые обсуждения совершеннейшая глупость, нельзя из пальца высосать описание работы сложной неизвестной системы. Да и вообще про днк вчера только узнали, ответы на подобные вопросы даются в результате сложной кропотливой дорогостоящей работы, а не в результате пустой болтовни, так что само обсуждение смысла не имеет.»

    — А что, теория эволюции имеет более весомые аргументы? Хм? Нет, конечно же. Это просто вера, религия. И инструмент атеистической веры к тому же.

    ОтветитьНравится
  • Николай Захаров  20 ноября, 12:06
    Теория эволюции — это аналог системы Птоломея в астрономии!

    Естественный отбор никто не отменяет, он реально существует. Но виды не трансформируются в друг друга.

    Товарищи эволюционисты («Птоломейцы»), поделитесь знаниями — как на Земле появилось семечко Дуба?

    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 12:28
    вообще то есть опыты по выведению других видов насекомых, которые в результате перестают скрешиваться с исходным видом и давать потомство
    ОтветитьНравится
  • Александр Вихров  20 ноября, 12:48
    Алексей Варежкин, есть куча выведенных пород, скажем, собак. Они сильно отличаются друг от друга, но имеют один и тот же генотип. Показать мутацию, ведущую к бульдогу или таксе никто не сумел. Как и получить из них вида. А опыты, которые дают виды двойники просто фиксируют нарушения в хромосомах. Морфология организма при этом не меняется. Уродство — вещь довольно обыденная.
    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 13:00
    кратко суть в следующем, бурутся простые быстроразмножающиеся насекомые паразитирующие на конкретном растении и пересаживаются на другое- долго и упорно на котором большинство погибает, со временем находятся выжившие и черз 500-800 поколений эти насекомые начинают питаться только новым растением и не выживать на старом и еще они ПЕРЕСТАЮТ СКРЕЩИВАТЬСЯ с исходным видом,
    то есть если это применить к собакам то для получения нового вида нужно не меньше (на какой год псобака потомство дает?если на второй ) 1000-1600 лет
    ОтветитьНравится
  • Николай Захаров  20 ноября, 13:31
    Алексей, это просто естественный отбор. Какими свойствами должен обладать новый вид?
    ОтветитьНравится
  • Александр Вихров  20 ноября, 13:39
    Алексей Варежкин, кошек и собак человечество выводит уже дольше. В ваших примерах нет главного — продемонстрированных мутаций и связанных с ними новых морфологических образований.
    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 13:56
    ну уж для начала бы попросили определение вида дать- вы вот как его понимаете
    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 13:57
    повторяюсь- обсуждение это пустое, кто как считает ни на что влиять не может, ответ должен быть дан в результате практической сложной работы а не философствований
    ОтветитьНравится
  • Александр Вихров  20 ноября, 14:34
    Алексей Варежкин, так от вас и ждут конкретных ответов, а не философствований по теме сложности работы, тогда как механизмы транскрипции и трансляции изучены досконально.
    ОтветитьНравится
  • Александр Ромашов  24 ноября, 22:29
    Честно, не понимаю механизмов, которые современные теоретики от генетики считают ответственными за эволюцию. Может я чего-то не понимаю, но основные проблемы следующие.
    Во-первых, они считают, что новые признаки появляются в результате мутаций. Конечно, теоретически мутация может вызвать появление не болезни, а относительно полезного признака. Но каковы шансы на то что это будет так, и какие шансы у такого признака закрепиться?
    Во-вторых, они экстраполируют процессы типа «прекращение перекрёстных связей» между видами (по региональным, временным, гормональным и др. причинам) до «появления генетической несовместимости» — скачок очень большой и совершенно необоснованный. Если у какой-либо деточки вдруг окажется не то число генов, что у его сородичей — то она сгинет так и не оставив нормального потомства. Если же она даже (о чудо!) оставит своё потомство, то в виду уникальности данного организма его генетическое разнообразие будет фактически нулевым, что приведёт его к весьма быстрой гибели новоиспечённого вида.
    В-третьих, напрягает отсутствие промежуточных звеньев. Можно кричать, что всё рано или поздно найдётся... но местами получается, что выживание неполноценного промежуточного вида можно объяснить только его изоляцией. Между тем, изоляция вида, насколько я знаю обычно ведёт к его вырождению — на фоне тех, кто эволюционировал на «большой земле» изолированно развивавшиеся виды всегда смотрятся блекло. И действительно, с чего бы им развиваться а не деградировать, если никто не мешает?
    Ну и наконец, у меня как программиста, есть серьёзные сомнения что закодировав всего-лишь какие-то белки можно дать начало полноценной жизни... Хотя, если светлым умам удастся в пробирке из неорганики создать способную питаться и размножаться амёбу, готов признать эти сомнения необоснованными.
    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 18:48
    «Хотя, если светлым умам удастся в пробирке из неорганики создать способную питаться и размножаться амёбу, готов признать эти сомнения необоснованными.»

    — Можно ли считать амебу живой?

    ОтветитьНравится
  • Николай Захаров  20 ноября, 13:31
    Про семечко Дуба — кто ответит?
    ОтветитьНравится
  • Алексей Варежкин  20 ноября, 13:58
    это к дедушке крылову- он там что то про желуди и корни вместе со свиньей поминал
    ОтветитьНравится
  • Qwerty Ujikol  21 ноября, 10:24
    +10!!))) Хоть и довольно грубо по отношению к данной теме обсуждения)
    ОтветитьНравится
  • Poмaн Coлжeницын  20 ноября, 14:57
    В клетке не может быть нулевой информации в принципе, т.к. она проходила длительный добиологический отбор.
    ОтветитьНравится
  • Александр Вихров  20 ноября, 17:02
    Роман Соложеницын, да как не крутите отбором, а эту информацию надо как-то на ДНК записать. А методов, кроме разумного, нет.
    ОтветитьНравится
  • Poмaн Coлжeницын  20 ноября, 17:33
    Речь об этом, как я понимаю:
    batrachos.com/node/469
    batrachos.com/node/471
    Если есть желание обсудить все подробнее, откройте тему на форуме: batrachos.com/forum/17
    Шабанов с удовольствием с вами побеседует на эту тему.
    ОтветитьНравится
  • Александр Вихров  20 ноября, 18:11
    Роман Соложеницын, эти агитки мне не интересны. Обсуждалось всё на разных форумах. Я привожу конкретную проверку СТЭ, отбор здесь не причем в принципе, речь о записи информации на ДНК.
    ОтветитьНравится
  • Poмaн Coлжeницын  20 ноября, 18:44
    То есть вы вообще отвергаете гипотезу мира РНК?
    ОтветитьНравится
  • Александр Вихров  21 ноября, 07:52
    Отвергаю, поскольку она даже теоретически не обеспечивает самокопирование и никаким образом не привязана к аминокислотам и, тем более, белкам. Но даже если её допустить, то это и есть нулевая информация — граничное условие
    ОтветитьНравится
  • Ильшат Тагиев  20 ноября, 14:59
    Кто будет спорить с тем, что статистически возникновение «жизни» маловероятно?

    А увеличение промежутка времени позволяет объяснить возникновение искомой комбинации, но совершенно не объясняет как эта комбинация продержалась хотябы ещё одно мгновение.

    Чем дольше существуют виды, тем невероятнее их существование!

    Но «теория полей», дальнодействия,
    www.membrana.ru/particle/16935
    «объясняет» (почти так же как религии «Божьими законами, волей»), что нарушение плотности вероятности происходит под действием «законов».

    А теперь внимание вопрос:
    «А с какой стати вообще существуют законы?»

    «Закон», действующий в пределах поля — это чисто информационное понятие, показывающее устойчивость следования одних событий после других, согласованность проявления одних событий вместе с другими.

    НО также «закон» показывает избирательность!!!
    «Закон» выбирает какие события последуют за другими,
    выбирает каким событиям следовать вместе с другими.

    А избирательность — это способность только сознательной деятельности.

    Наличие сознания у человека, человека, являющегося частью природы и действующего в пределах её «законов», вынуждает поднять вопрос о существовании сознания на всех других уровнях «тел».

    И, что возникновению видов предшествовало возникновение сознаний.
    www.membrana.ru/particle/16161

    ОтветитьНравится
  • Ильшат Тагиев  20 ноября, 15:20
    Есть ещё один «парадокс статистического возникновения жизни».

    Для того, что бы искомая комбинация возникла, она не должна быть устойчивой, иначе новые комбинации не возникли бы.

    НО для того, чтобы искомая комбинация сохранилась, она должна быть устойчивой, иначе новые комбинации уничтожили бы её.

    ОтветитьНравится
  • Ильшат Тагиев  20 ноября, 15:22
    То есть возникающие комбинации должны быть и устойчивыми и неустойчивыми в раз.
    ОтветитьНравится
  • Алексей Ромчак  20 ноября, 21:21
    Ильшат, какое отношение имеет эта тавтология к теме затронутой в статье?
    ОтветитьНравится
  • Александр Морозов.  20 ноября, 21:24
    Самое непосредственное. Как Асташкину надо во все темы воткнуть, что он все давным-давно в Болгарии разработал, то Тагиеву надо напихать ссылок на свои высеры. Привлечение внимания вот и все.
    ОтветитьНравится
  • Алексей Ромчак  20 ноября, 22:55
    Я уже который раз пытаюсь ему намекнуть, что его ссылки не только не уместны, но и не скромны.
    ОтветитьНравится
  • Александр Морозов.  20 ноября, 23:05
    Я вообще поражаюсь «таланту» не воспринимать критику в свой адрес на протяжении такого времени да и еще от немыслимо большого количества совсем разных людей. Наверное у нас политики такие же как этот тип.
    ОтветитьНравится
  • Алексей Ромчак  20 ноября, 23:14
    Я уже где-то советовал Ильшату пойти на юридический с его «талантом» упорно повторять одну и ту же чушь, но усомнился, что судьи смогут долго его терпеть. А вот в политике самое то, электорат у нас терпимый.
    ОтветитьНравится
  • Ильшат Тагиев  21 ноября, 00:08
    Алексей Ромчак,

    Связь наипрямейшая!

    Нарушение плотности вероятности «официалы» объясняют действием законов в пределах поля...

    ОтветитьНравится
  • Ильшат Тагиев  21 ноября, 00:27
    Подобно распределению молекул под действием «поля» гравитации.
    ОтветитьНравится
  • Александр Морозов.  21 ноября, 08:18
    Ой кто бы говорил, сначала смысл слов которые выдавливаете из себя поймите.
    ОтветитьНравится
  • «То есть возникающие комбинации должны быть и устойчивыми и неустойчивыми в раз.»
    Ильшат — проблема в среде.
    По одной из версий образование РНК происходит в жерлах черных курильщиков — давление за 300 атмосфер и температура за сотню. В таких условиях они становятся очень «не устойчивыми» или, проще говоря — более подвижными. Покидая жерло, они теряют температуру и становятся более устойчивыми. Тут то, собственно, и определяется их жизнеспособность.
    ОтветитьНравится
  • Александр Вихров  21 ноября, 13:21
    Шутите. Они там просто разрушаются. Ваще нуклеотиды клетки имеют азотистые основания двух типов: пурины и пиримидины. Миллер их исследовал. У него одни образуются при отрицательных температурах, другие — при положительных. А в вулкане вся органика сгорит нафиг.
    ОтветитьНравится
  • Владимир Королёв  21 ноября, 14:27
    Сознание возникает не на всех уровнях, сознание это эмерджентное свойство сложной системы человеческого мозга. Эволюция способствует усложнению систем, которые начинают получать новые свойства не соответствующие сумме свойств частей этой системы.

    Так и жизнь зародилась благодаря эмерджентности. Разобрали до молекул- жизни нет. Появилась хоть одна устойчивая система- хорошо, но мало, появилась самореплицирующаяся система- превосходно — новая эпоха эволюции.

    ОтветитьНравится
  • В каком вулкане?
    ОтветитьНравится
  • Ильшат Тагиев  24 ноября, 22:28
    Александр Викторович Васильев,

    Если изменения в ДНК (и не только) происходили бы только с изменением среды, то сколько бы потребовалось времени, чтобы создать всё имеющееся многообразие видов?

    ОтветитьНравится
  • Ильшат Тагиев  24 ноября, 23:11
    Теория случайной эволюции гласит, что вот
    1) Случайные мутации рано или поздно приведут к удачной комбинации.
    2) Новый вид размножится до огромного количества, чтобы создать «почву» для нового отбора среди случайных мутаций.
    3) Старый вид не будет уничтожен новым, а встроется в экосистему, где есть новый вид, т.е. опять таки изменится, приспособится, но не мутируя, иначе...

    То есть шаг за шагом создаётся многообразие.

    НО!

    Во-первых, постулируется наличие механизма наследования этих удачных мутаций потомками (а не «сброс» их, например в результате скрещивания с «обычными сородичами») (видовая нескрещиваемость)

    Во-вторых, постулируется наличие механизма размножения вообще (не важно в «кого» потомки, хоть от мухи слонята)

    В-третьих, постулируется наличие механизма согласования видов (наследования социального удачного изменения), так как согласование иначе тоже должно происходить случайно, уничтожая многие внутренне, ДНК и т.п., удачные виды, но социально не удачные.

    А с какой стати должны быть эти механизмы???

    Поэтому сознание или т.п. должно быть (и появляться) на всех уровнях, от домолекулярного, молекулярного, до над молекулярного (социального) уровней.

    Когда мы смотрим на что-то сделанное руками человека (мобильный телефон), почему мы делаем вывод, что это рукотворное тело???

    Потому, что в нём много деталей, которые СОГЛАСОВАНЫ!!!
    Именно это и отличается сознательную деятельность человека от несознательной, случайной, деятельности (содержащей очень много «самогашений», беспорядка, внутренних противоречий...)

    И ещё один важный момент.
    Деятельность человека, животных, сознательна?
    (ну, хотя бы в значительной части, — да)

    Если деятельность человека, животных, лежит внутри механизма случайной эволюции, то остаётся ли такая эволюция случайной???

    Конечно, можно было бы сказать, что каждый человек, животное, в отдельности ведёт себя сознательно, но в целом толпа ведёт себя случайным образом.

    НО мы видим множество примеров организованной деятельности в животном мире!!!
    А значит и надорганизмы ведут не случайную, а сознательную деятельность.

    И кстати, кто сомневается в том, что «человек» — это «надорганизм» для жизни клеточного уровня?!

    ОтветитьНравится
  • Александр Морозов.  24 ноября, 23:15
    Кишка у вас тонка поднимать подобные вопросы, кроме усмешки это УГ ничего не вызывает. Читайте книжки.
    Эволюция это фундаментальное свойство локальной вселенной, наравне со временем и измерениями.
    ОтветитьНравится
  • Ильшат Тагиев  24 ноября, 23:18
    ПВО№2
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 11:57
    антиПВО № 42
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:01
    Сначала придумал механизмы, потом сказал что их не должно быть, а потом этим доказал, что все камни думают! Браво!
    ОтветитьНравится
  • Алексей Ромчак  25 ноября, 12:04
    А кто ни будь, знает что это его «ПВО№2» такое? Уж вставлять в любой теме ссылки, ведущие на его тавтологию он может, ну давал бы и на «ПВО№2».
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:12
    может — это засланец...он пишет пишет, а вы реагируете. :-)
    ОтветитьНравится
  • Алексей Ромчак  25 ноября, 12:15
    Кто Тагиев? Очень может быть, например с Марса.
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:19
    или с мембраны
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:20
    человеческий бот
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:54
    для бота он довольно ловко вихляет словами, половина из которых он не понимает, но его манера сочетать фразы проходит тест тьюринга на раз. может конечно мембрана в тихаря создала ИИ.))
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:57
    да ладно...в 2005 натыкалась на многих чатах на бот- чат мастер назывался. Люди часами с ним болтали и даже не понимали, что это не человек. Он сам записывал вопросы и ответы на них, а потом использовал их...
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 13:02
    да ща эти чатботы еще больше эволюционировали. есть же такие сайты, там вообще весь мир им опыт общения прививает. Такие боты говорят тоже проходили тест положительно. А один вообще в телевикторине обошел людей. Но все эти боты не умели фантазировать на ходу, они использовали только накопленный опыт и базу знаний, импровизации не получалось. Как только начнут импровизировать- тогда ИИ не за горами.
    ОтветитьНравится
  • Ильшат Тагиев  26 ноября, 00:02
    Алексей Ромчак,
    про ПВО читайте в комментах тут
    от 27 мая, 15:39
    www.membrana.ru/particle/16162
    ОтветитьНравится
  • Алексей Ромчак  26 ноября, 00:17
    Ильшат, Вы уж меня извините, но сегодня я уже изучал статью Коганицкого в поисках описания секретного мотор-колеса, так и не нашел, пришлось самому придумывать. Но он хоть и выносит мозг, все-таки технически грамотный, о Вас я при всём уважении такого не скажу. И ещё раз укажу вам на то, что показывать свои «каки» при любом случае не скромно, а скромность украшает.
    ОтветитьНравится
  • 5 млрд — это очевидно :-)
    ОтветитьНравится
  • хотя, если верить палеонтолагам всяким, то 60 млн лет назад вымерло 95% видов.
    Цифра, я так понимаю, очень условная, но даёт представление о скорости повышения многообразия.
    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:12
    «Сознание возникает не на всех уровнях, сознание это эмерджентное свойство сложной системы человеческого мозга. Эволюция способствует усложнению систем, которые начинают получать новые свойства не соответствующие сумме свойств частей этой системы.
    Так и жизнь зародилась благодаря эмерджентности. Разобрали до молекул- жизни нет. Появилась хоть одна устойчивая система- хорошо, но мало, появилась самореплицирующаяся система- превосходно — новая эпоха эволюции.»

    — Эх, сказочник. А что компьютер-то не разумен, милок?

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:16
    «Кишка у вас тонка поднимать подобные вопросы, кроме усмешки это УГ ничего не вызывает. Читайте книжки.
    Эволюция это фундаментальное свойство локальной вселенной, наравне со временем и измерениями.»

    — А как насчет Большого Взрыва, возникшего из нулевого объема, то есть из ничего? Почему оно возникло? Как?

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:19
    «да ща эти чатботы еще больше эволюционировали. есть же такие сайты, там вообще весь мир им опыт общения прививает. Такие боты говорят тоже проходили тест положительно. А один вообще в телевикторине обошел людей. Но все эти боты не умели фантазировать на ходу, они использовали только накопленный опыт и базу знаний, импровизации не получалось. Как только начнут импровизировать- тогда ИИ не за горами.»

    — Тормози, не так шустро. Ишь, как фантазия разогналась. Ведь сначала должны вороны обогнать в эволюционировании людей, и поработить их. А тут железяка. Не порядок :-).

    ОтветитьНравится
  • Владимир Королёв  27 декабря, 14:33
    Шамиль, давай я один раз тебя попрошу не комментировать и не отвечать мне на мои посты, а я не буду описывать и пытаться критиковать твой словесный понос. Договорились? Нам тут без тебя хватает фриков на форуме, а еще читать этот жёский оверквотинг, это просто капец. Нельзя одну фразу скопировать, а не весь пост? Ты же хозяин компьютера. Короче ты мне надоел.

    Так же предлагаю тебе это соглашение с другими оформить. Останутся те, кому интересно твоё мировоззрение.

    ОтветитьНравится
  • Shamil Dzhanbolatov  28 декабря, 18:41
    «Шамиль, давай я один раз тебя попрошу не комментировать и не отвечать мне на мои посты, а я не буду описывать и пытаться критиковать твой словесный понос. Договорились? Нам тут без тебя хватает фриков на форуме, а еще читать этот жёский оверквотинг, это просто капец. Нельзя одну фразу скопировать, а не весь пост? Ты же хозяин компьютера. Короче ты мне надоел.
    Так же предлагаю тебе это соглашение с другими оформить. Останутся те, кому интересно твоё мировоззрение.»

    _Диалог — это не попытка договориться, дать взятку, и т.п.

    ОтветитьНравится
  • Врэж Багратуни  20 ноября, 23:54
    Насчёт разнообразия видов. Думаю генетическая стабильность образовалась в природе не вдруг. Это приобретение природы тоже приходило постепенно. И посему раньше видообразование происходило легче, мутировали сразу целые комплексы. И горизонтальное приобретение чужих генов тогда было намного более частым тогда. Необходимо найти те генетические комплексы делающие стабильным геном, а затем проследить как и когд они образовались. Возможно даже в геноме есть гены, главная функция которых специально вносить новые изменения в геном. «Прыгающие гены» на эту роль подходят. В этом случае слово мутации не совсем подходят.
    ОтветитьНравится
  • Ильшат Тагиев  21 ноября, 00:05
    .Только синхронизированность изменений ДНК (и не только) вида может обеспечить живучесть новому виду.

    И вот на этом-то и запарывается теория случайного видообразования.

    ОтветитьНравится
  • Врэж Багратуни  21 ноября, 00:10
    Скорее всего в этом вопросе необходимо строить секторальную теорию вероятности. А развитие и подгонка секторов, даже основанная на мутационных изменениях, может дать синхронность преобразований.
    ОтветитьНравится
  • Врэж Багратуни  21 ноября, 00:11
    Это нечто близкое к знаменитому эффекту «сотой обезьяны».
    ОтветитьНравится
  • Александр Вихров  21 ноября, 08:12
    Вреж Ванун, как забраться на Эверест? Постепенно — сначала подойти к подножию, затем на 100 м выше и тд. Как долететь к Фобосу? Постепенно — сначала вывести станцию на земную орбиту, потом соориентировать ее по звездам, включить движок, подлететь и сесть.
    Постепенность — это просто хронология, не решение задачи, а уход от проблем. Можно не объяснять, как получились прыгающие гены. Постепенно:)))
    ОтветитьНравится
  • Врэж Багратуни  21 ноября, 09:00
    Есть вполне убедительная теория, что развитие происходит скачками, в периоды острых природных катаклизмов. А сотни миллионов лет назад, по моим подозрениям гены не были столь стабильны и большие изменения в них происходили много чаще чем сейчас. По генетическим часам учёные могли бы попробовать доказать мою правоту, в генетической хронологии это должно быть вполне заметно.
    ОтветитьНравится
  • Почему запарывается то?
    Ну не подтвердилась живучесть вида... Берём следующую комбинацию и всё.
    ОтветитьНравится
  • Вреж, в катаклизмы скачками происходит не развитие, а изменение, позволяющие организму выжить. Изменения случайны. Природа тупо подбирает удачную комбинацию.
    Все не удачные дохнут... во время катаклизма.
    ОтветитьНравится
  • Врэж Багратуни  21 ноября, 11:35
    Верно, но если к этому добавить то, что стабильность генов тогда была, отнюдь, не такой, как сейчас. Может виды тогда были более пластичны, чем теперь?
    ОтветитьНравится
  • Александр Вихров  21 ноября, 12:22
    Вреж Ванун, если нет стабильных генов, то нет и запоминания найденногог решения. Вообще, система репликации генов не может функционировать нормально, если число ошибок больше 10^-4 на нуклеотид на поколение. Просто, идет вразнос.
    ОтветитьНравится
  • Александр Вихров  21 ноября, 13:23
    Александр Викторович, ну и все куры в курятнике сдохли. Остались одни идеи.
    ОтветитьНравится
  • Не исключено.
    «Пластичность видов» вполне можно объяснить «количеством попыток».
    Чем проще организм, тем больше ему требуется оставить потомства для продолжения рода. Сколько гриб выбрасывает спор? Сколько семян разбрасывает растение? Рыба икринок? Ящерицы и прочие земноводные? Млекопитающие?
    С усложнением системы количество удачных попыток растёт. Рыбе нужно отложить тысячи икринок, что бы 1-2 дожили до репродуктивного возраста и дали потомство. Черепахам достаточно уже полсотни яиц для такого результата. Млекопитающим 5-6. У людей вообще практически все выживают.
    ОтветитьНравится
  • Больно большой у нас курятник, что бы вот так вот взять и сдохнуть))))
    Вообще рассматривается катаклизм как моментальное явление, но это не совсем правильно. Даже если на планету упадёт метеорит, не так страшен его удар по сравнению с теми изменениями которые он произведёт с течением времени. Но именно это и даёт возможность видам приспособиться!!! Даже крупные млекопитающие, за исключением приматов, способны к репродукции уже через полгода. Мелочь типа крыс и мышей — 2 месяца.
    ОтветитьНравится
  • Александр Вихров  21 ноября, 16:33
    Александр Викторович Васильев, ну так у вас просто еще одно опровержение СТЭ. Лососю, который мечет 20 млн икринок любые мутации до задницы. Он выживает гарантированно.
    ОтветитьНравится
  • Лосось это не вид.
    Это по моему класс... или подкласс лососевых ;-)
    ОтветитьНравится
  • только им не мутации до задницы (это их изобретение собстна), а агрессивность среды.
    так что очевидно вы правы. он выживает гарантированно :-)
    ОтветитьНравится
  • Врэж Багратуни  22 ноября, 01:37
    Это верно, но я немножко другое говорил.
    ОтветитьНравится
  • Александр Ромашов  24 ноября, 22:47
    Как объясняет наука то, что более простые организмы развиваются медленнее, несмотря на то, что всё вроде бы в их пользу — минимальный срок репликации, огромная выборка, естественный отбор в самом непосредственном виде (не осложнённый взаимоотношениями внутри популяции и т.п.) Думаю что «пластичность» в плане эволюции не должна сильно зависеть от указанных параметров. А устоявшиеся виды простейших, насекомых, раков, ящериц и т.п. достаточно пластичны чтобы переживать всяческие катаклизмы без заметного эволюционирования.
    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:21
    «Насчёт разнообразия видов. Думаю генетическая стабильность образовалась в природе не вдруг. Это приобретение природы тоже приходило постепенно. И посему раньше видообразование происходило легче, мутировали сразу целые комплексы. И горизонтальное приобретение чужих генов тогда было намного более частым тогда. Необходимо найти те генетические комплексы делающие стабильным геном, а затем проследить как и когд они образовались. Возможно даже в геноме есть гены, главная функция которых специально вносить новые изменения в геном. «Прыгающие гены» на эту роль подходят. В этом случае слово мутации не совсем подходят.»

    — У леди есть машина времени оказывается :-)

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:24
    «Вреж, в катаклизмы скачками происходит не развитие, а изменение, позволяющие организму выжить. Изменения случайны. Природа тупо подбирает удачную комбинацию.
    Все не удачные дохнут... во время катаклизма.»

    — Природа сама создает катаклизмы и сама же с ними борется. Откуда силушки?

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:27
    Где промежуточные формы? Их должно быть даже больше в качественном отношении
    ОтветитьНравится
  • а всё вокруг — промежуточные формы. Конечной формы просто нет.
    ОтветитьНравится
  • природа — это набор взаимосвязанных (открытых) систем.
    идиотский вопрос всмысле.
    ОтветитьНравится
  • Shamil Dzhanbolatov  4 января, 14:32
    «природа — это набор взаимосвязанных (открытых) систем.
    идиотский вопрос всмысле.»

    _"Эволюция" не часть природы? Конечно часть. Вы считаете природу вечным двигателем?

    ОтветитьНравится
  • Shamil Dzhanbolatov  4 января, 14:34
    «а всё вокруг — промежуточные формы. Конечной формы просто нет.»

    _Я уже говорил об этом. Тогда по вашему получается, что медведь вдруг сразу превращается в моржа. Большие мутации приводят только к инвалидности, уродствам и дефектам, много раз показано на экспериментах

    ОтветитьНравится
  • Антон Брандт  21 ноября, 03:32
    Вообщето существуют/существовали переходные виды, подвиды, родственные виды и прочее.
    Кроме того, теория эволюции (как и любого другого динамического процесса) подразумевает движение не по прямой, а по спирали.
    Это значит, что сперва копятся мелочи, изменения в питании, среде обитания, климате, географии и прочем, потом находится мощный фактор мутагенеза, — большинство приспособится не может и гибнет.
    Те кто выжили, сохранили приобретенные ранее полезные изменения и стали родоначальниками нового вида.

    И потом, то, что межвидовой барьер не является абсолютным, вовсе не означает, что все виды на планете должны рано или поздно эволюционировать в 1 и тот же вид.

    ОтветитьНравится
  • Александр Вихров  21 ноября, 08:16
    Антон Брандт, все тот же уход от проблемы появления информации.
    Гибнуть должны все, поскольку мутации в подавляющем большинстве вредны, а отбор носит элиминирующий характер.
    ОтветитьНравится
  • Вот именно, что в подавляющем большинстве!!!
    но та часть которая выживает — начинает плодиться и занимать образовавшиеся пустоты.
    ОтветитьНравится
  • Александр Вихров  21 ноября, 12:16
    Александр, бездоказательно. Ошибки накапливаются и должны сломать сам механизм репродукции. Все механизмы ломаются. Вечного двигателя нет. Храповик Меллера должен был уничтожить жизнь.
    ОтветитьНравится
  • Исключено.
    Тот набор генов, который в результате случайной мутации привёл к сбою системы репродукции, не передастся потомству, а значит нет шансов переноса его на весь вид.
    Инстинкт размножение — это базовый инстинкт.
    ОтветитьНравится
  • Александр Вихров  21 ноября, 16:35
    Александр Викторович Васильев, идет накопление ошибок и снижение репродуктивности популяции вцелом.
    ОтветитьНравится
  • Антон Брандт  21 ноября, 14:28
    Вихров, глупо считать мутации ошибками.
    Все живые существа на планете постоянно подвержены мутациям.
    Факторов мутагенеза множество.
    Но, для того чтобы произошел качественный скачок и появился новый вид количество положительных мутаций должно скопиться в определенную критическую массу.
    Более того, особей, достигших подобной критической массы, должно быть достаточно много, чтобы достижения нового вида закрепились и смогли быть переданы по наследству.
    Но не все смогут приспособиться, выжить и дать потомство.
    А выжившие не все образуют один вид.
    Умрут миллионы существ, чтобы выжили тысячи, и эти тысячи дадут жизнь десяткам новых видов.
    И так будет продолжаться до тех пор, пока в изменившейся среде обитания не будут заняты все экологические ниши (приспособившимися к изменениям видами), и биосфера не прийдет в равновесие.

    Но вы сами понимаете, что так происходит редко, чаще всего факторов мутагенеза недостаточно, для создания нового вида, да и часть мутаций вредоносна, а иногда и смертельна.

    Но, тем не менее, нет оснований считать синтетическую теорию эволюции ошибочной.

    ОтветитьНравится
  • Александр Вихров  21 ноября, 16:45
    Антон Брандт, случайная мутация — ошибка репликации по определению. Другое дело, если она неслучайна, а к этому генетика, в общем-то, и подходит. Насчет скопления положительных мутаций вы явно загнули. Они жутко мизерны, даже по подсчетам эволюционистов — только одна из 10^7 положительная. Если добавить мизерность мутаций как таковых — 10^-8 и необходимость небольшой изолированной популяции для достижения гомозиготности, которая все равно очень маловероятна, потому как мутирует только одна аллель гена из 4-х родительских, то получится в реале пшик.
    ОтветитьНравится
  • Сергей Скалба  21 ноября, 19:12
    Тем не менее, я за «синтетику». Случайная мутация, или не случайная — об этом трудно судить: естественный отбор направлен не только на организм, но и на условия существования. А новые условия существования могут отбирать нужные мутации. Т.е. «веришь ты в это, или не веришь, главное — работает».
    ОтветитьНравится
  • Врэж Багратуни  22 ноября, 02:39
    Сейчас некоторые утверждают, что и Лысенко по своему был прав. Среда может намного более активно формировать гены, чем полагали раньше. К 50-60 мутациям, которые в норме отличаются детёныши от родителей, необходимо прибавить некоторую осмысленную самомутацию в генах.
    Плюс горизонтальный обмен генами, который тоже оказался нормой даже на уровне организмов, а не только микроорганизмов.
    Плюс комбинация симбиотов в организме и в самих клетках могут начать резко изменять вид. Один из этих симбиотов став митохондрией вообще породил класс теплокровных. В человеке на 30 трлн. клеток приходится почти в сто раз больше всяких полезных и вредных микробов, бактерий и вирусов. Они стабильно живут в нас. Между ними вечные войны в нас за место под сракой.
    Подавляющее большинство микроорганизмов весьма полезны, без них мы не выжили бы. Совокупность их генов в миллион раз больше, чем наши несчастные 25 тысячи генов. Продукты жизнедеятельности микроорганизмов в нас напрямую влияют на нас, влияют, даже на нашу психику. После приёма антибиотиков это всеми легко ошущается.
    К тому же изминения наступают не только от наличия генов, но и от алгоритма экспрессии этих генов, в том числе от мусорных генов.
    Так что нечего удивлятся если в экстремальных эпохах, тем более в те далёкие, не столь зрелые, как сейчас времена, изминения геномов могут быть весьма и весьма обширными и решительными. Из суммы всех этих факторов другая вероятностная математика следует. Просчитывать необходимо функционирование намного большей массы генов, которые к тому же изначально очень динамичны. Тупая теория вероятности выглядит арифметикой третьекласника, при обсчёте живого организма и возможности его изменений.
    ОтветитьНравится
  • Александр Вихров  22 ноября, 06:54
    Сергей Скалба, ну верите вы в ЕО, какая разница? Это все та же умственная абстракция, которую невозможно увидеть, проверить и зарегистрировать, как и бог. Насчет работоспособности ЕО это тоже фантазии.
    ОтветитьНравится
  • Сергей Скалба  22 ноября, 18:36
    ЕО, насколько я знаю это Ежедневное Обслуживание (В свое время служил танкистом), в него я верю. Но что вы имели в виду?
    ОтветитьНравится
  • Сергей Скалба  22 ноября, 18:45
    Лысенко обьяснял это по-другому, не как Вы. Согласно его теории, например, если родителей, из поколения в поколение учить плавать, то в конце концов, появится такая пара, у которых дети буду уметь плавать по наследству
    ОтветитьНравится
  • Ольга Добрая  22 ноября, 18:48
    новорожденные дети с рождения умеют плавать независимо от способностей родителей.
    ОтветитьНравится
  • Ольга Добрая  22 ноября, 18:50
    от блин...не вставилось
    еще хотела дописать как только начинают держать головку
    ОтветитьНравится
  • Врэж Багратуни  23 ноября, 02:39
    Так я примерно это и имел ввиду. Я же не имел ввиду, что при необходимости тут же и вырастают крылья.
    ОтветитьНравится
  • Александр Вихров  23 ноября, 05:56
    Статья, воолбще-то, не для танкистов. ЕО — естественный отбор.
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:03
    ну да, так дельфины и появились
    ОтветитьНравится
  • Сергей Скалба  26 ноября, 17:26
    Александр Вихров: «Статья, воолбще-то, не для танкистов. ЕО — естественный отбор»
    Я не пиарюсь, просто иначе долго объяснять почему ЕО — «ежедневное обслуживание». Ноесли на то пошло, то мне здесь вообще нет места — ведь кем я только не был.
    ОтветитьНравится
  • Сергей Скалба  26 ноября, 17:28
    Это точно — все умеют плавать. А отсюда вывод — Великий потоп был. Все кто не умел плавать — утоп.
    ОтветитьНравится
  • Сергей Скалба  26 ноября, 17:34
    Теперь, когда я узнал что действительно означает ЕО, скажу что я присоединяюсь к вашим сомнениям насчет его эффективности, тем более, что компьютерное моделирование показало его неэффективность.
    ЕО способен только убирать то что «нехорошо», но создавать он ничего не может. Да и оценивать, что хорошо, а что плохо путем ЕО — не самый лучший способ.
    ОтветитьНравится
  • Сергей Скалба  26 ноября, 17:41
    Ни что само отрасти не может. Сначала «его» надо создать.Например: перепонки между пальцами — что б получились ласты, сами не получаться, как бы бедное животное не старалось достичь этого. (например, роняя на ноги камни)
    Предварительно, оно должно переселиться в воду и жить там продолжительное время. Т.е. первичным является не ЕО, а выбор (изменение) места обитания.
    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:35
    «Вихров, глупо считать мутации ошибками.
    Все живые существа на планете постоянно подвержены мутациям.
    Факторов мутагенеза множество.
    Но, для того чтобы произошел качественный скачок и появился новый вид количество положительных мутаций должно скопиться в определенную критическую массу.
    Более того, особей, достигших подобной критической массы, должно быть достаточно много, чтобы достижения нового вида закрепились и смогли быть переданы по наследству.
    Но не все смогут приспособиться, выжить и дать потомство.
    А выжившие не все образуют один вид.
    Умрут миллионы существ, чтобы выжили тысячи, и эти тысячи дадут жизнь десяткам новых видов.
    И так будет продолжаться до тех пор, пока в изменившейся среде обитания не будут заняты все экологические ниши (приспособившимися к изменениям видами), и биосфера не прийдет в равновесие.
    Но вы сами понимаете, что так происходит редко, чаще всего факторов мутагенеза недостаточно, для создания нового вида, да и часть мутаций вредоносна, а иногда и смертельна.
    Но, тем не менее, нет оснований считать синтетическую теорию эволюции ошибочной.»

    — Эволюционисты не нашли «предков» для большинства видов кембрийского взрыва. Никаких накопленных постепенных слабых мутаций не нашли.

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:37
    "Тем не менее, я за «синтетику». Случайная мутация, или не случайная — об этом трудно судить: естественный отбор направлен не только на организм, но и на условия существования. А новые условия существования могут отбирать нужные мутации. Т.е. «веришь ты в это, или не веришь, главное — работает».

    — У мужика есть машина времени. Сказочник.

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:40
    ""Тем не менее, я за «синтетику». Случайная мутация, или не случайная — об этом трудно судить: естественный отбор направлен не только на организм, но и на условия существования. А новые условия существования могут отбирать нужные мутации. Т.е. «веришь ты в это, или не веришь, главное — работает».

    — Где факты случайного образования? Где промежуточные формы? Как объяснить кембрийский и другие взрывы? Все решили разом про эволюционировать за кратчайший период времени, эволюционировать от кого? Большинству кембриев «предков» эволюционисты не нашли. Отбор от кого к кому, если нет промежуточных форм?

    ОтветитьНравится
  • Shamil Dzhanbolatov  26 декабря, 19:42
    «Сейчас некоторые утверждают, что и Лысенко по своему был прав. Среда может намного более активно формировать гены, чем полагали раньше. К 50-60 мутациям, которые в норме отличаются детёныши от родителей, необходимо прибавить некоторую осмысленную самомутацию в генах.
    Плюс горизонтальный обмен генами, который тоже оказался нормой даже на уровне организмов, а не только микроорганизмов.
    Плюс комбинация симбиотов в организме и в самих клетках могут начать резко изменять вид. Один из этих симбиотов став митохондрией вообще породил класс теплокровных. В человеке на 30 трлн. клеток приходится почти в сто раз больше всяких полезных и вредных микробов, бактерий и вирусов. Они стабильно живут в нас. Между ними вечные войны в нас за место под сракой.
    Подавляющее большинство микроорганизмов весьма полезны, без них мы не выжили бы. Совокупность их генов в миллион раз больше, чем наши несчастные 25 тысячи генов. Продукты жизнедеятельности микроорганизмов в нас напрямую влияют на нас, влияют, даже на нашу психику. После приёма антибиотиков это всеми легко ошущается.
    К тому же изминения наступают не только от наличия генов, но и от алгоритма экспрессии этих генов, в том числе от мусорных генов.
    Так что нечего удивлятся если в экстремальных эпохах, тем более в те далёкие, не столь зрелые, как сейчас времена, изминения геномов могут быть весьма и весьма обширными и решительными. Из суммы всех этих факторов другая вероятностная математика следует. Просчитывать необходимо функционирование намного большей массы генов, которые к тому же изначально очень динамичны. Тупая теория вероятности выглядит арифметикой третьекласника, при обсчёте живого организма и возможности его изменений.»

    — Ну и где факты, находки? Где эти вымершие неудачники, где промежуточные формы. Как это объясняет кембрийский и другие взрывы? Никак.

    ОтветитьНравится
  • Сергей Скалба  26 декабря, 21:42
    причем здесь машина времени?
    ОтветитьНравится
  • Shamil Dzhanbolatov  27 декабря, 12:14
    «причем здесь машина времени?»

    — Притом, что нафантазировать что-то правдоподобное про то, что эволюция была много ума не надо. Вон сколько уже теорий и версий на фантазировали. А факты где?

    ОтветитьНравится
  • Сергей Скалба  29 декабря, 02:25
    А на что надо много ума, и где факты в пользу этой версии?
    Тем более, что я не один раз уже говорил, что «жизнь никогда не возникала». Только ради всех богов, не приписывайте эту фразу убогим виталистам. Здесь дело гораздо интереснее.
    ОтветитьНравится
  • Алёна Кажамяка  29 декабря, 03:40
    Шамиль, твой кратчайший промежуток длился миллионы лет) это больше, чем один только плейстоцен, за который успели появится и помереть мамонты и саблезубые тигры — 1 млн лет. Кембрий длился 60 млн лет и организмы усложнялись на всем его протяжении. К сравнению — за те же 60 млн лет — из мышевидных млекопитающих — до человеков доросли в компании с разнообразнейшими семействами..
    ОтветитьНравится
  • Александр Иерархов  29 декабря, 04:04
    К сравнению — за те же 60 млн лет — из мышевидных млекопитающих — до человеков доросли в компании с разнообразнейшими семействами..
    --------------------------------------

    С какой верой сказано... На этом фоне вера Шамиля убога...

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 13:48
    «Шамиль, твой кратчайший промежуток длился миллионы лет) это больше, чем один только плейстоцен, за который успели появится и помереть мамонты и саблезубые тигры — 1 млн лет. Кембрий длился 60 млн лет и организмы усложнялись на всем его протяжении. К сравнению — за те же 60 млн лет — из мышевидных млекопитающих — до человеков доросли в компании с разнообразнейшими семействами..»

    _Опять цепляются к словам. Сначала пришлось добавить из-за этого «в качественном отношении». К Вики обратитесь что ли. Сочувствую.

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 13:50
    «А на что надо много ума, и где факты в пользу этой версии?
    Тем более, что я не один раз уже говорил, что «жизнь никогда не возникала». Только ради всех богов, не приписывайте эту фразу убогим виталистам. Здесь дело гораздо интереснее.»

    _Ваша ВЕРА понятна

    ОтветитьНравится
  • Алёна Кажамяка  29 декабря, 13:57
    У вас, похоже, Вики с исламским акцентом) другая..
    Потому что именно оттуда общие понятия и привожу. Ну, жаль, что не могу сейчас мембране уделять много внимания, работа, понимаете-ли)))
    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 14:13
    «А на что надо много ума, и где факты в пользу этой версии?
    Тем более, что я не один раз уже говорил, что «жизнь никогда не возникала». Только ради всех богов, не приписывайте эту фразу убогим виталистам. Здесь дело гораздо интереснее.»

    _Ответ здесь, в комментариях к статье о «преимуществах живорождения», к статье о пальце слона.

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 16:28
    «У вас, похоже, Вики с исламским акцентом) другая..
    Потому что именно оттуда общие понятия и привожу. Ну, жаль, что не могу сейчас мембране уделять много внимания, работа, понимаете-ли)))»

    _Все у вас как-то не выходит факты приводить. Какая досада, надо же. Как раз именно сейчас нет времени.

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 16:46
    «Шамиль, твой кратчайший промежуток длился миллионы лет) это больше, чем один только плейстоцен, за который успели появится и помереть мамонты и саблезубые тигры — 1 млн лет. Кембрий длился 60 млн лет и организмы усложнялись на всем его протяжении. К сравнению — за те же 60 млн лет — из мышевидных млекопитающих — до человеков доросли в компании с разнообразнейшими семействами..»

    _И что?

    ОтветитьНравится
  • Poмaн Coлжeницын  29 декабря, 17:20
    http://www.youtube.com/watch?v=FtcVzPyToNQ
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 04:46
    «http://www.youtube.com/watch?v=FtcVzPyToNQ»

    _Посмотрел. Занятно, но заведомо не честно. Так как заведомо игра ведется по правилам эволюционистов, к примеру отрицается, что это мог быть искусственный вирус, который создали инопланетяне, и испытали его сначала на обезьянах, потом точно так же на людях, с целью изменить генофонд людей, также как это хотят сделать нынешние люди, к примеру для лечения генетических болезней. Многие контактировавшие с инопланетянами, по их словам, получили от них информацию, что генофонд через вирусы регулярно подправляется, я читал цифру 130 лет. Я уже говорил об этом, вы не внимательны. Древо якобы общих предков человека и обезьяны — выдумка — рисунки выполнены просто по одной-двум костям, полно случаев подделок, которые обнаруживались случайно, что говорит о низком качестве критики достоверности в этой области. Также в вашем фильме упускается, что мусульмане и иудеи считают, что многие обезьяны происходят от людей, если не верите в чудеса можете считать это чем-то вроде квантового эффекта, не случайного конечно. Христиане это почему-то упорно отрицают. Вот недавно люди заразились от обезьян СПИДом, заражаются те же места или разные? Те же места, не так ли? Также передаются и другие болезни. Часть мусульман считает, что микроорганизмы — не живые существа, то есть что-то вроде роботов. Про малую возможность встраивания точно в том же месте, что и у обезьян далее: да, это не могло быть случайностью. Это может быть только разумное вмешательство. Но давайте допустим, что это случайно, в том смысле, что не управляемо постоянно Творцом. Может быть такое из-за скрещивания обезьяны и человека? Наверно да? И почему так опасаются не проверенных на безопасность ГМО? Потому что есть случаи вредного воздействия (в том числе заражения вирусами ретро), но так же может быть, что из еды или раны эти зараженные клетки попали от обезьян к человеку и стали делиться у человека, человек при этом имел слабый иммунитет и не сопротивлялся, из-за небольшого сходства ДНК человека и обезьяны. Из-за сходства ДНК человека вирус перешел именно туда, где она была и у обезьян. И к тому же, если ДНК человека и обезьяны так похожи, почему вирус не мог встроиться в одни и те же места? Кстати, русские, скандинавы, имеют повышенную защиту против ретровирусов, тогда как у обезьян он намного слаб. Вообще, насколько я читал, ретровирусов вообще может не существовать, многие ученые считают, что этот вирус создали недавно искусственно, или его нет вовсе, это плохо изучено (к примеру СПИД может иметь аутоимунную сущность). Также я читал. Что есть остатки некоторого древнего сопротивления ретровирусам у человека и обезьян. Что многие из этих вирусов даже полезны при родах (!), или безвредны. Если этот ретровирус заражал другого человека в то же место ДНК, то и обезьянами могло быть тоже самое, из-за близости ДНК людей и обезьян. Если он передался по наследству, то должна быть у всех людей и обезьян только одна пара предков — муж и жена. Что невозможно, кроме Адама и Евы (атеисты их могут называть по другому, сути это не меняет, или их потомков, оказавшихся тоже в количестве двух, из-за эпидемии.

    Это может быть как иммунным ответом, конечно же и у человека и у обезьяны иммунный ответ ДНК будет одинаковым, так как отличия между ними малы. Возможно существует только одно место ДНК куда могут встроиться эти остатки ретровирусов, встраивания в другие места ДНК могут привести не к иммунитету, а наоборот, и выживут только те обезьяны и люди у которых строго в одном месте остатки ретровирусов. «По одной из версий, встроенные вирусные последовательности могли защищать носителей от заражения полноценными вирусами. В пользу такой точки зрения косвенно свидетельствуют несколько фактов. Например, лошади, которые особенно уязвимы перед борнавирусами, не имеют их последовательностей в своем геноме, а у летучих мышей, способных передавать вирус Эбола, не заболевая, в геноме есть последовательности вируса Эбола.» (http://kyp-p.ru/genom_medic.html )

    Инфицирование может быть и при браках, когда все друг другу становятся «заново» родственниками.

    Меня удивляет то, сколько пользы (или вреда) могут приносить эти остатки «ретровирусов», может их и вовсе нет. Так как они выполняют важные функции, то может быть важная родная часть ДНК человека и обезьяны, просто похожи на ретровирусы из-за схожих функций (подавление иммунитета для оплодотворения- не вирус, но похож. И для заражения другой — уже вирус.

    «По этим данным получается, что структуры, подобные ВИЧ, обобщенно называемые ретроэлементами, и есть геном человека. Ретротранспозируемые элементы (ретроэлементы) делят на две большие группы: способные к автономному существованию (эту их «автономность» нельзя понимать буквально, так как они зависят от ферментов репарации ДНК хозяина, необходимых для их транспозиции) и неавтономные.»

    Согласно новым данным то, что считалось ранее мусорным ДНК им не является, а активно работает, что означает еще больший разрыв между обезьянами и человеком, чем считалось ранее. Это автоматом означает, что случайное попадание фрагментов ретровирусов в ДНК человека и обезьян исключены, иначе это не медленно отражалось бы на эмбрионе, что не наблюдается.

    Итак:

    1) Люди могли скрещиваться с шимпанзе
    2) Согласно новым данным то, что считалось ранее мусорным ДНК им не является, а активно работает, что означает еще больший разрыв между обезьянами и человеком, чем считалось ранее. Это автоматом означает, что случайное попадание фрагментов ретровирусов в ДНК человека и обезьян исключены, иначе это не медленно отражалось бы на эмбрионе, что не наблюдается.
    3) Разумное изготовление и заражение инопланетянами или/и Богом для образования новых рас, к примеру.
    4) Обезьяны произошли от людей в результате разумного вмешательства (наказание)
    5) Заражение не половым путем.

    Продолжение следует

    ОтветитьНравится
  • Александр Иерархов  30 декабря, 04:50
    На rutracker.org/forum/viewtopic.php?t=1986111 Может пошлёт аллах, на недельку заткнёшся...
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 04:54
    К тому же методы генного анализа не совершенны, при отклонениях, не похожести более 30% программы ничего не заметят. Что ставит под сомнение достоверность вашего фильма.
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 04:55
    «На rutracker.org/forum/viewtopic.php?t=1986111 Может пошлёт аллах, на недельку заткнёшся...»

    _"Форум временно отключен" — по вашей ссылке

    ОтветитьНравится
  • Александр Иерархов  30 декабря, 05:18
    Тебе ж аллахоид, русским языком написано что «временно»...
    ОтветитьНравится
  • Александр Иерархов  30 декабря, 05:30
    Кстати Уважаемый, Вы против эволюции потому что аллах предписывает или как оно?
    ОтветитьНравится
  • Poмaн Coлжeницын  30 декабря, 09:54
    http://evolbiol.ru/evidence06.htm
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 10:56
    «Кстати Уважаемый, Вы против эволюции потому что аллах предписывает или как оно?»

    _Типа того. Да и не бывает так в жизни, чтобы случайность была создателем жизни, тут хотя бы вопрос в проблеме сохранения стерильности молекул живых существ. Это все равно как если бы на меня с неба упал мешок денег — пустая трата времени.

    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 11:13
    «Тебе ж аллахоид, русским языком написано что «временно»...»

    _Спасибо за ссылку

    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 11:46
    «http://evolbiol.ru/evidence06.htm»

    «Антиэволюцинизм, напротив, не может предложить никаких внятных объяснений наблюдаемого единства генетического кода у всех организмов. Творец вполне мог бы снабдить разные виды сотворенных им существ разными генетическими кодами — ну хотя бы для того, чтобы не вводить биологов во искушение, предоставляя им еще один чрезвычайно весомый довод в пользу эволюции. К тому же это было бы и полезно для организмов, так как предотвратило бы межвидовую передачу болезнетворных вирусов. Именно таким путем человек „обзавелся“ вирусами оспы (от рогатого скота), СПИДа (от обезьян), гриппа и др. Чисто „технически“ разные варианты кода совершенно равнозначны и работать смогли бы одинаково хорошо.» — Сходства — ДНК, могут и объяснять то, что Творец Один — Бог, что касается остального — разве не для испытаний мы на этой земле? Вместо фактов за эволюцию демагогия.

    „Различия между геномами видов должны соответствовать не только экспериментально наблюдаемым типам мутаций, но и филогенетическому дереву, и палеонтологической летописи. Подобно тому, как анализ ДНК позволяет установить степень родства между двумя людьми, тот же самый анализ ДНК (сравнение отдельных генов или целых геномов) позволяет выяснить степень родства между видами, а зная количество накопленных различий, исследователи определяют время расхождения двух видов, то есть время, когда жил их последний общий предок. Например, согласно данным палеонтологии, общий предок человека и шимпанзе жил примерно 6 миллионов лет назад (такой возраст имеют, например, ископаемые находки оррорина и сахелантропа — форм, морфологически близких к общему предку человека и шимпанзе). Для того, чтобы получилось наблюдаемое число различий между геномами, на каждый миллиард нуклеотидов должно было приходиться в среднем 20 изменений за одно поколение. Сегодня у людей скорость мутаций составляет 10-50 изменений на каждый миллиард нуклеотидов за одно поколение(Giannelli, F., Anagnostopoulos, T., Green, P. M. Mutation rates in humans. II. Sporadic mutation-specific rates and rate of detrimental human mutations inferred from hemophilia B.), то есть данные палеонтологии согласуются с результатами анализа ДНК, в строгом соответствии с теорией эволюции (см. материал Genetic rates of change из архиваTalkOrigins.org.) « — А почему другие объяснения невозможны? Невозможно, потому что этого не может быть вообще? Ответ выше. Бог так мог сделать, чтобы удобно было людям испытывать лекарства и т.п на обезьянах.

    „ Нет никаких априорных причин, кроме происхождения от общего предка, по которым два разных вида должны были бы иметь хотя бы отдаленно похожие последовательности ДНК для кодирования нормально работающего (функционального) цитохрома c. То же самое справедливо и для других белков. Тем не менее аминокислотные последовательности большинства белков у близкородственных видов (например, у шимпанзе и человека), как правило, очень похожи. Так, подавляющее большинство гомологичных белков человека и шимпанзе различаются лишь на 1-2 аминокислоты или не различаются вовсе. Различий в нуклеотидных последовательностях обычно больше за счет незначимых, или синонимичных (не влияющих на аминокислотную последовательность белка) нуклеотидных замен.
    По соотношению несинонимичных и синонимичных нулеотидных замен (dN/dS) можно определить, насколько сильно действует на данный ген „очищающий“ отбор, отбраковывающий мутации, которые меняют свойства белка. Как правило, чем консервативнее (постояннее) функция белка, тем ниже этот показатель. ПовышениеdN/dS свидетельствует о положительном отборе, т.е. о закреплении полезных  мутаций. Например, повышенное значение dN/dS у человека по сравнению с другими млекопитающими зафиксировано в гене FOXP2, который связан со способностью к произнесению членораздельных звуков (см.: Будут ли расшифрованы генетические основы разума?; „Ген речи“ FOXP2 оказался регулятором высокого уровня).
    Малое число различий в аминокислотных последовательностях белков у близких видов связано не только с тем, что эти различия еще не успели накопиться, но и с тем, что многие одинаково удачные для выполнения данной функции аминокислотные последовательности (см. выше) отделены друг от друга так называемыми „ямами в ландшафте приспособленности“. Это значит, что для того, чтобы перейти от одной такой последовательности к другой, функционально равнозначной, нужно приобрести сразу несколько мутаций, каждая из которых по отдельности может снижать функциональность белка. Многие из этих „ям“ можно обойти, последовательно приобретая ряд нейтральных мутаций, но это долгий процесс, основанный на случайностях, а не на позитивном отборе, и поэтому он занимает много времени (см.: The Molecular Sequence Evidence из архива TalkOrigins.org.)“ — Тут уже откровенная фантазия и введение в заблуждение. Ответ выше. Нет промежуточных видов с этими нейтральными мутациями, найденные около несколькхи десятков промежуточных форм — слишком мало. Да и на самом деле это вымершие расы людей или вымершие обезьяны.

    „Таким образом, дело здесь не просто в сходстве ДНК, дело в характере сходства, которое выходит далеко за пределы любой функциональной оправданности. Особенно важно сходство по бессмысленным частям генетического „текста“ (сюда относится и использование одинаковых синонимичных кодонов), а также по характерным ошибкам в нем (см. ниже об эндогенных ретровирусах и псевдогенах). Для любого специалиста по сравнительной геномике кровное родство человека и шимпанзе абсолютно очевидно и не вызывает даже тени сомнения. Опытный учитель сразу поймет, что один ученик бездумно списал у другого, если заметит в их сочинениях не только одинаковые мысли (это еще можно объяснить одинаковыми намерениями авторов), но и одинаковые фразы, используемые для их выражения, а особенно — одинаковые ошибки и одинаковые сорные словечки в одних и тех же местах текста. Все эти бесспорные признаки единства происхождения (а не независимого сотворения) в величайшем изобилии присутствуют в геномах близкородственных видов, каковыми являются человек и шимпанзе. 
    Сравним теперь аминокислотные последовательности того же самого фрагмента цитохрома b у шимпанзе, человека и макаки резуса:
    Pan    MTPTRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
    Homo   MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
    Macaca MTPMRKSNPILKMINRSFIDLPAPPNLSMWWNFGSLLAACLILQIITGLLLAMHYSPDTS
    Как видим, у макаки аминокислотная последовательность этого белка сильнее отличается от человеческой и шимпанзиной, чем последовательности первых двух видов друг от друга (14 аминокислотных различий между макакой и шимпанзе, 13 — между макакой и человеком, 2 — между шимпанзе и человеком). Это полностью соответствует биологической систематике и эволюционному дереву (шимпанзе — гораздо более близкий родственник человека, чем макака). То, что по одной аминокислоте (4-й) макака больше похожа на человека, чем на шимпанзе, означает, что, скорее всего, у общего предка макаки и человекообразных в этой позиции стояла аминокислота M, которая сохранилась у макаки и человека. Однако в линии шимпанзе, уже после ее отделения от человеческой линии, произошла замена M наT.
    Интересно взглянуть на ситуацию с точки зрения шимпанзе. Для этого вида человек — более близкий родственник, чем любая другая обезьна. Даже горилла, внешне не так уж сильно отличающаяся от шимпанзе (по крайней мере на наш человеческий взгляд), приходится шимпанзе более дальней родственницей, чем человек. В свою очередь, для гориллы люди и шимпанзе — самые близкие родственники, значительно более близкие, чем любые другие обезьяны.
    Таким образом, результаты сравнения генов и белков подтверждают представления о родственных связях между видами (эволюционном дереве), которые сложились задолго до „прочтения“ геномов. Аналогичные результаты получаются при сравнении практически любых генов в любых группах организмов. Каждый читатель может убедиться в этом самостоятельно, поскольку все прочтенные гены и программное обеспечение для их анализа находятся в свободном доступе.“ — Уже отвечал ранее.
    «Единство генетического кода широко используется в биотехнологии. Например, бактериям встраивают ген человека, отвечающий за выработку инсулина, и бактерии начинают синтезировать человеческий гормон.
    Также можно отметить крайне похожие пути метаболизма в клетках всех организмов. Так, гликолиз у всех эукариот и у большинства прокариот проходит за 10 одинаковых шагов, в одной и той же последовательности, с использованием одних и тех же десяти ферментов (при том что возможны тысячи различных, но термодинамически эквивалентных путей гликолиза). У всех изученных видов основным переносчиком энергии в клетке является аденозинтрифосфат (АТФ), хотя на эту роль могли бы претендовать сотни других молекул (см.: The fundamental unity of life из архива TalkOrigins.org)." — Вначале пишут, что единство для многих живых существ — ДНК — плохо (болезни, искушение эволюцией и т.п), а тут уже пишут, — что хорошо (биотехнологии, лечение генетических болезней). Чудеса противоречия.

    „У всех человекообразных обезьян по 24 хромосомы, за исключением людей, у которых лишь 23 хромосомы. Человеческая 2-я хромосома является результатом слияния двух хромосом предков (Alec MacAndrew. Human Chromosome 2 is a fusion of two ancestral chromosomes).“ — У них я смотрю машина времени. Фантазируют покрепче любого сказочника. Различия в количестве хромосом довольно серьезно и удивляет на фоне большого сходства в ДНК.

    „Хромосома человека соответствует двум хромосомам обезьян. Ближайший человеческий родственник, бонобо, имеет практически идентичные находящимся 2-й хромосоме человека последовательности ДНК, но они расположены на двух отдельных хромосомах. То же самое верно и для более дальних родственников: гориллы и орангутана (см.: Comparison of the Human and Great Ape Chromosomes as Evidence for Common Ancestry)
    На хромосоме человека имеются рудиментарные центромеры. Обычно хромосома имеет только одну центромеру, но на длинном плече 2-й хромосомы наблюдаются остатки второй.
    Кроме того, на хромосоме человека имеются рудиментарные теломеры. Обычно теломеры находятся только на концах хромосомы, но последовательности нуклеотидов, характерные для теломер, наблюдаются ещё и в середине 2-й хромосомы“ — То, что ранее неоднакратно серьезно ошибались в чем-то эволюционисты, их не остнавливает, дедукция и слабые косвенные предположения заменяют факты у них — это и есть наука? А почему так же действовать креационистам нельзя — сразу начинается, что это не научно.
    „Эндогенные ретровирусы представляют собой следы древних вирусных инфекций в ДНК. Ретровирусы (такие как ВИЧ и Т-лимфотропный вирус человека, вызывающий лейкоз и лимфому) встраивают собственный геном в геном клеток зараженного организма. Обычно после этого клетка начинает продуцировать новые копии вируса. В этом процессе возможны сбои: копирование встроенной вирусной последовательности подавляется клеткой хозяина. Сама вируснаяпоследовательность остается в структуре хромосомы. Если вирус встроился в геном стволовой половой клетки, то встроенную вирусную последовательность могутунаследовать потомки инфицированной особи. Ретровирусы встраиваются в геном случайным образом, вероятность независимой встройки одинаковых вирусов на одинаковые позиции у двух разных организмов пренебрежимо мала. А значит, встроенный геном одного и того же ретровируса может присутствовать у двух животных на одной и той же позиции в ДНК только в том случае, если эти животные произошли от общего предка.
    Около 1 % человеческого генома занимают эндогенные ретровирусы, всего таких последовательностей в ДНК каждого человека около 30000 (Е. Д. СвердловRetroviruses and primate evolution). Некоторые из этих ретровирусов встречаются только у человека. Другие последовательности встречаются только у шимпанзе и у человека, причем в одних и тех же позициях в геноме (тем самым подтверждается происхождение человека и шимпанзе от одного предка). Также есть последовательности, встречающиеся у горилл, шимпанзе и человека, у орангутанов, горилл, шимпанзе и человека, и так далее (см.: Endogenous retroviruses из архиваTalkOrigins.org). Распределение эндогенных ретровирусов в точности соответствует филогенетическому дереву. См. также: Предки человека заимствовали полезные гены у вирусов
    Также можно привести пример из семейства кошачьих. У малых кошек (точнее — у таких животных, как камышовый кот, европейская лесная кошка, степная кошка и домашняя кошка) найдена общая ретровирусная вставка. Ни у каких других хищников этот ретроген не обнаружен.“ — Отвечал уже ранее.

    „Антиэволюционистам практически нечего возразить на совершенно убийственный для них „аргумент от эндогенных ретровирусов“. Иногда они пытаются утверждать, что эндогенные ретровирусы якобы выполняют полезные функции в геноме многоклеточных организмов, и этим якобы объясняется их присутствие в одних и тех же местах генома у человека и шимпанзе и т.д. Но все эндогенные ретровирусы человека на самом деле неактивны, они давно утратили свою активность в результате мутаций. Другое дело, что в ходе эволюционного процесса, получившего название „молекулярное одомашнивание“, некоторые отдельные фрагменты ретровирусных геномов (но не целые геномы) иногда „кооптируются“ хозяином для выполнения каких-то полезных функций (см. в заметках: Предки человека заимствовали полезные гены у вирусов; Наездники подавляют иммунную защиту своих жертв при помощи прирученных вирусов). Большинство встроенных ретровирусных геномов, однако, совершенно бесполезны для хозяина, да и „молекулярное одомашнивание“ никоим образом не может объяснить факт их присутствия в одних и тех же местах в геномах разных видов.“ — Отвечал ранее

    „Псевдогены — это неработающие, „молчащие“ гены, которые возникают в результате мутаций, выводящих нормальные „рабочие“ гены из строя (существуют и другие, более редкие пути возникновения псевдогенов). Псевдогены представляют собой настоящие „генетические рудименты“. Если мутация выведет из строя ген, полезный для организма, она почти наверняка будет отсеяна отбором. Однако некоторые гены, в прошлом полезные, могут стать ненужными, например, из-за смены образа жизни. Мутация, выводящая из строя такой ген, не отсеивается отбором и может закрепиться в популяции. Псевдогены могут долго сохраняться в геноме в качестве ненужного „балласта“. Мутации, которые в дальнейшем будут происходить в псевдогене, безразличны для выживания организма, и поэтому такие мутации свободно накапливаются и в конце концов могут изменить псевдоген до неузнаваемости. Однако на это уходит обычно много времени (десятки или даже сотни миллионов лет). Поэтому в геномах большинства организмов, включая человека, псевдогены на той или иной стадии мутационной деградации присутствуют в больших количествах. Псевдогены представляют собой своеобразную „историческую хронику“, рассказывающую об образе жизни и адаптациях далеких предков изучаемого организма.
    Например, в геноме человека в псевдогены превратились многие гены обонятельных рецепторов. Это и понятно, поскольку обоняние не имело существенного значения для выживания людей в историческое время, и, по-видимому, в доисторическое тоже (подробнее см. в заметке: Обоняние и цветное зрение в эволюции млекопитающих развивались в противофазе).
    Ярким доказательством эволюции является присутствие одинаковых псевдогенов в одних и тех же местах генома у видов, произошедших сравнительно недавно от общего предка. Так, у человека есть псевдоген GULO, который представляет собой „сломанный“ ген фермента глюконо-лактон-оксидазы. Этот фермент необходим для синтеза аскорбиновой кислоты. У других приматов обнаружен точно такой же псевдоген, причем мутационная „поломка“, нарушившая работу гена, у него такая же, как и в человеческом псевдогене. Причины очевидны: в связи с переходом предков современных приматов к питанию растительной пищей, богатой витамином C,данный ген перестал быть необходимым для выживания. Мутация, испортившая ген, не была отсеяна отбором, закрепилась и была унаследована обезьянами и человеком. У других млекопитающих (например, у крысы) GULO является не псевдогеном, а работающим геном, и поэтому крысам не нужно получать витамин C с пищей: они синтезируют его сами. В других группах млекопитающих, которые независимо от приматов перешли к питанию пищей, богатой витамином С, тоже произошла псевдогенизация гена GULO, но мутации, выведшие ген из строя, у них были другие (пример — морские свинки).
    Еще один пример: у млекопитающих есть три гена, которые у птиц и рептилий отвечают за производство белка вителлогенина, который входит в состав желтка в яйце. Почти у всех млекопитающих эти три гена — „мертвые“, псевдогенизированные. Только яйцекладущие однопроходные звери (утконос, ехидна) синтезируют вителлогенин. У однопроходных из трех генов вителлогенина „мертвы“ только два, а третий сохранил функциональность. Между прочим, хотя у плацентарных мелкопитающих желток не образуется, в ходе эмбриогенеза развивается рудиментарный желточный мешок (наполненный жидкостью), присоединенный к кишечнику зародыша. На втором месяце беременности у человека желточный мешок отделяется от эмбриона.
    Подробнее о доказательствах эволюции, предоставляемых псевдогенами, см.: Sean D. Pitman. Pseudogenes.“ — Отвечал из многого уже ранее. Остальное — просто мутации и/или из-за сходства в ДНК всего живого, что подтверждает Одного Творца. Иначе были, к примеру, млекопитающие, без вместо ДНК с чем-то другим, если он не инопланетянин конечно.

    ОтветитьНравится
  • Владимир Королёв  30 декабря, 11:55
    Я думаю что просто бог на протокомпе копипастой занимался и те же самые комбинации ЕРВ из чимпов в гомосапов вставлял. А потом фильтры в Adobe Creator God Edition забабахал, шерстистость и цвет кожи ползунками поправил, ну и скилов накидал. Человеку интеллидженс, шимпанзе ловкость, а горилле силу.
    ОтветитьНравится
  • Владимир Королёв  30 декабря, 12:04
    Шамиль поразил, инопланетянами. А они что поперек воли ал-лаха в ДНК его людей свободно так меняют все комбинации у всех жителей планеты одновременно и у всех обезьян и у всех млекопитающих и у всех хордовых и у всех вторичноротых и у всех многоклеточных. В общем издевались над всеми и полностью у каждого ДНК переработали. Ну не чушь?

    Спид не поражает те же участки, И он вообще не поражает все клетки, а только больные, и он не у всех. Вирус должен заразить ДНК половой клетки всех живых существ в соответствующих местах, если нет эволюции, и только предковых организмов, если есть эволюция. простая математика. Вероятность что нет эволюции- почти равна нулю, вероятность что есть- почти единица.

    ОтветитьНравится
  • Владимир Королёв  30 декабря, 12:07
    спасибо за копипасту, теперь вся инфа которая тебя опровергает в этой ветке.
    ОтветитьНравится
  • Сергей Скалба  30 декабря, 14:03
    Шамиль Джанболтаев: 29 декабря, 14:13
    «_Ответ здесь, в комментариях к статье о „преимуществах живорождения“, к статье о пальце слона».

    А статья-то, тю-тю.
    Да бог с ней, со статьей. А эту фразу, что «жизнь никогда не возникала», я впервые услышал от биолога, который лет 30 тому назад сравнял меня с землей на заседании Ученого совета в ИЭМ (Институт Экспериментальной Медицины, павловский отдел, г. Санкт-Петербург).
    Наверно поэтому впоследствии он оказал нам огромную помощь в понимании роли функциональной асимметрии, и литературой снабдил.
    Одна только мысль о креатизме или самозарождении жизни выводила его из себя. Живая и неживая природа — это как курица и яйцо. Вот в этом направлении,"молодой человек" и работайте — разговаривали мы сидя на огромном диване, оставшемся еще от Павлова.

    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 16:04
    «Шамиль поразил, инопланетянами. А они что поперек воли ал-лаха в ДНК его людей свободно так меняют все комбинации у всех жителей планеты одновременно и у всех обезьян и у всех млекопитающих и у всех хордовых и у всех вторичноротых и у всех многоклеточных. В общем издевались над всеми и полностью у каждого ДНК переработали. Ну не чушь?
    Спид не поражает те же участки, И он вообще не поражает все клетки, а только больные, и он не у всех. Вирус должен заразить ДНК половой клетки всех живых существ в соответствующих местах, если нет эволюции, и только предковых организмов, если есть эволюция. простая математика. Вероятность что нет эволюции- почти равна нулю, вероятность что есть- почти единица.»

    _Кроме этого я еще много о чем писал. Прочтите то место, где написано, что мусорной ДНК не существует, а следовательно если ретро вирусы и существуют (а почему я должен считать, что там именно ретро вирусов остатки, а не мутация?). Вот вам еще пища для размышления infox.ru/science/lab/2011/09/20/YEda_pyeryeprogrammi.phtml

    Фрагменты ДНК вируса могут использоваться специально как вспомогательные молекулы для иммунного ответа или как так же как обычная пища с готовыми молекулами используется, а не синтезируется самостоятельно. Новые данные об отсутствии мусорных генов, могут означать, что встраивание некоторых чужеродных молекул ретровирусов — вполне специальный и контролируемый процесс клеток. Иначе любые такие случайные встраивания в большом количестве сказывались плачевно на эмбрионе. Чего не наблюдается. Такие встраивания — довольно редкие и упорядоченные, что даже вполне возможно происходит у человека и шимпанзе независимо друг от друга, но похоже. Уважаемый, многие большие ученые вообще сомневаются в существовании вируса СПИДА, это может быть аутоиммунная проблема.

    Ну не над всеми издевались и не со всеми работали, не утрируйте. Так, обычные эксперименты, если их проводя люди, разве их не могли инопланетяне проводить тысячелетия назад? А если бы они показались, то многие бы подумали, что они происходят от обезьян шимпанзе или наоборот. Если инопланетяне многие окажутся похожими на людей в плане ДНК, будет ли это ударом для эволюционистов? Какова вероятность случайности такой?

    ОтветитьНравится
  • Владимир Королёв  30 декабря, 16:11
    бред
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 18:36
    «спасибо за копипасту, теперь вся инфа которая тебя опровергает в этой ветке.»

    _Вместе с ответами.

    ОтветитьНравится
  • Владимир Королёв  30 декабря, 20:29
    але, ты читать то умеешь? или только писать?
    ОтветитьНравится
  • Shamil Dzhanbolatov  30 декабря, 21:39
    «але, ты читать то умеешь? или только писать?»

    _Ваше ничего не доказывает. У вас нет машины времени. ДНК вообще до конца не изучен. Вы навязываете свое мнение. Я давно ответил. Говорите более конкретно.

    ОтветитьНравится
  • Shamil Dzhanbolatov  31 декабря, 00:45
    «Скорее всего, их ДНК уже навсегда утеряна, разложилась. Я не верю в то, что у нас когда-нибудь будет Парк юрского периода.»
    _Что не мешает эволюционистам уверенно, клятвенно, и главное НАУЧНО, считать только по внешним признакам, что археоптерикс — промежуточное звено (чуть ли не единственное при этом почему-то(!) между динозаврами и птицами. Возражения не принимаются и предаются анафеме как не научные, и, о ужас, псевдонаучные
    ОтветитьНравится
  • Shamil Dzhanbolatov  31 декабря, 02:31
    «А на что надо много ума, и где факты в пользу этой версии?
    Тем более, что я не один раз уже говорил, что «жизнь никогда не возникала». Только ради всех богов, не приписывайте эту фразу убогим виталистам. Здесь дело гораздо интереснее.»

    _Лучше тратить миллиарды налогов верующих. коих более 90% от общего населения на создание машины времени, чем на пустую попытку доказать теорию эволюции

    ОтветитьНравится
  • Владимир Королёв  31 декабря, 10:43
    прекрати проповедничать, назови хоть одного человека с мембраны кому это интересно.
    ОтветитьНравится
  • Владимир Королёв  31 декабря, 17:56
    что так ине нашел здесь единомышленников? изображаешь святого мученника невежду?
    ОтветитьНравится
  • Shamil Dzhanbolatov  1 января, 04:05
    «прекрати проповедничать, назови хоть одного человека с мембраны кому это интересно.»

    _Я смотрю вам по крайней мере это интересно.

    ОтветитьНравится
  • Shamil Dzhanbolatov  1 января, 04:06
    «что так ине нашел здесь единомышленников? изображаешь святого мученника невежду?»

    _Ну так покажите, что вы не невежда, если уж меня обвиняете в этом. Ждемс.

    ОтветитьНравится
  • Владимир Королёв  2 января, 01:07
    мне просто интересно насколько далеко человек может заблуждаться, а так бред мне не интересен.
    ОтветитьНравится
  • Владимир Королёв  2 января, 01:09
    вот еще фанатику буду чего то доказывать, делать мне больше нечего.
    ОтветитьНравится
  • Shamil Dzhanbolatov  2 января, 03:08
    «мне просто интересно насколько далеко человек может заблуждаться, а так бред мне не интересен.»

    _Мне тоже, глядя на вас.

    ОтветитьНравится
  • Shamil Dzhanbolatov  2 января, 03:10
    «вот еще фанатику буду чего то доказывать, делать мне больше нечего.»

    _Правильно, а то еретиком станешь, сменишь религию святого пророка Дарвина. Который после смерти дочери вдруг стал чем-то вроде атеиста.

    ОтветитьНравится
  • Владимир Королёв  2 января, 13:32
    считаешь все бредом? вали в форум исламофилов!
    ОтветитьНравится
  • Владимир Королёв  2 января, 13:33
    что как попугай заладил, Дарвин -ученый, если муслимы его в святые пророки возвели, то я не виноват.
    ОтветитьНравится
  • Shamil Dzhanbolatov  2 января, 18:28
    «считаешь все бредом? вали в форум исламофилов!»

    _Не все, не понятно. А вот вы считаете, что кто-то застолбил этот сайт и обозначил мочой свою территорию. Обезьянка, покажи мне, где на этом сайте написано, что этот сайт — сайт антиисламистов.

    ОтветитьНравится
  • Владимир Королёв  3 января, 04:54
    а по статьям трудно догадаться, что сайт освещает? есть хоть одна статья происламско православно креационистская? и наррд тут соответствующий. один только вот борец экстремист, зарабатывает девственниц, уже 47.
    ОтветитьНравится
  • Shamil Dzhanbolatov  3 января, 23:58
    «а по статьям трудно догадаться, что сайт освещает? есть хоть одна статья происламско православно креационистская? и наррд тут соответствующий. один только вот борец экстремист, зарабатывает девственниц, уже 47.»

    _Прочитайте правила сайта, они запрещают теологические разговоры, на которые вы и ко постоянно меня провоцируете и оскорбляете, пишете ошибочную инфу об Исламе. Я иногда использую исламские знания как одно из решений, пути движения, выхода из трудного положения.

    ОтветитьНравится
  • Ольга Добрая  21 ноября, 16:44
    накопление критических ошибок, которые исправить страховочная копия не в силах.
    ОтветитьНравится
  • Антон Брандт  21 ноября, 16:50
    Откуда эта циферь, Вихров?
    Без серьезного источника это пшик.
    ОтветитьНравится
  • Александр Вихров  22 ноября, 06:56
    Антон Брандт, все цифры из научных и научно-популярных источников, далеко не религиозных.
    ОтветитьНравится
  • Врэж Багратуни  22 ноября, 02:38
    Сейчас некоторые утверждают, что и Лысенко по своему был прав. Среда может намного более активно формировать гены, чем полагали раньше. К 50-60 мутациям, которые в норме отличаются детёныши от родителей, необходимо прибавить некоторую осмысленную самомутацию в генах.
    Плюс горизонтальный обмен генами, который тоже оказался нормой даже на уровне организмов, а не только микроорганизмов.
    Плюс комбинация симбиотов в организме и в самих клетках могут начать резко изменять вид. Один из этих симбиотов став митохондрией вообще породил класс теплокровных. В человеке на 30 трлн. клеток приходится почти в сто раз больше всяких полезных и вредных микробов, бактерий и вирусов. Они стабильно живут в нас. Между ними вечные войны в нас за место под сракой.
    Подавляющее большинство микроорганизмов весьма полезны, без них мы не выжили бы. Совокупность их генов в миллион раз больше, чем наши несчастные 25 тысячи генов. Продукты жизнедеятельности микроорганизмов в нас напрямую влияют на нас, влияют, даже на нашу психику. После приёма антибиотиков это всеми легко ошущается.
    К тому же изминения наступают не только от наличия генов, но и от алгоритма экспрессии этих генов, в том числе от мусорных генов.
    Так что нечего удивлятся если в экстремальных эпохах, тем более в те далёкие, не столь зрелые, как сейчас времена, изминения геномов могут быть весьма и весьма обширными и решительными. Из суммы всех этих факторов другая вероятностная математика следует. Просчитывать необходимо функционирование намного большей массы генов, которые к тому же изначально очень динамичны. Тупая теория вероятности выглядит арифметикой третьекласника, при обсчёте живого организма и возможности его изменений.
    ОтветитьНравится
  • Сергей Асташкин  24 ноября, 07:53
    -- Про Лысенко, примерно есть такое дело на уровне эпигенических механизмов.. По горизонтальному переносу: тут нужно чётко предстадлять себе сущность, а она следующая: когда он осуществляется в примерно одноуравневых бактериях и одноклеточных простейших — там гены могут работать в «своих» лицах,когда он случайно окажется в многоклеточной ДНК — он НИКОГДА не работает ! он просто новый материал-глина в ДНК для переработки ! Это качественное отличие причин и следствий.. Гены в микроорганизмах на процентов 70% похожи на наши.. так что полегче и несчастными 25 тыс..наших генов.. основных кишечной флоры -гдето около 20 видов считаем по 1000генов оставим 30% ..?? что останется ?
    ОтветитьНравится
  • Врэж Багратуни  24 ноября, 11:49
    Вот ещё один фактор. Очень новая и очень важная информация.
    Еда перепрограммирует наши гены

    infox.ru/science/lab/2011/09/20/YEda_pyeryeprogrammi.phtml
    Китайские ученые придали смысл расхожей фразе «Мы – то, что мы едим». Они показали, что маленькие молекулы, поступающие в организм человека с растительной пищей, могут влиять на работу его генов.
    Сенсационное открытие опубликовали исследователи из Университета Нанкина (Nanjing university) в журнале Cell Research. Речь идет о микроРНК – небольших последовательностях из 19-24 нуклеотидов. Они не кодируют белки, но выполняют важные регуляторные функции – связываются с матричной РНК (мРНК) и, таким образом, вмешиваются в процесс синтеза белков. В последнее время ученые получают все новые и новые данные об их роли в организме и связывают с ними разные патологии, от глухоты до диабета.
    Что мы съедаем вместе с рисом
    Однако с тем, что эти молекулы могут распоряжаться не только в своем, но и в чужом организме, Чжан Ченью(Chen-Yu Zhang) и его команда столкнулись впервые. Они обнаружили, что разновидность микроРНК (MIR168a), характерная для клеток риса, присутствует в плазме крови китайцев, которым рис, как известно, служит основой рациона. Прежде всего, ученые удивились тому факту, что чужеродные молекулы не расщеплялись на составные кирпичики, как им положено, в пищеварительном тракте, а целыми поступали в кровь. А затем стали изучать, что, собственно, они там делают.
    Механизм действия MIR168a исследователи выяснили уже не на человеке, а в культуре клеток и на лабораторных мышах, в которых они вставили нужные человеческие гены.
    МикроРНК хозяйничают в чужом геноме
    И тут выяснились интересные вещи: оказалось, что MIR168a связываясь с мРНК, снижает синтез рецептора липопротеинов низкой плотности (LDLRAP1). «Рисовая» микроРНК подавляет работу этого рецептора в печени и, тем самым, мешает удалению ЛПНП из плазмы крови.
    Итак, биологи получили доказательство того, что чужеродная микроРНК из растительной пищи в ненарушенном виде поступает в кровь млекопитающих и изменяет работу определенных генов, а, тем самым, влияет на обмен веществ.
    Это можно сравнить с «горизонтальным переносом генов» (феномен, когда гены передаются не потомкам, а неродственным организмам), который широко распространен у прокариотов. Именно таким путем бактерии быстро приспосабливаются, например, к антибиотикам.
    Поедание информации
    Открытие роли микроРНК из риса ученые рассматривают как «передачу информации», которая происходит с пищей. Иными словами, мы получаем с пищей не только питательные вещества для нашего метаболизма, но и информацию, которая определенным образом перепрограммирует наши гены.

    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 10:11
    -- Нет, нельзя сравнить, переносом ГЕНОВ называется встраивание его в ГЕНОМ хозяина и последующее воспроизедение в поколениях и ничего более.. насчёт микрорнк — не так всё просто важно что поределилось оработа мирРНК 168а а у неё ещё есть и другие функции..
    ОтветитьНравится
  • Врэж Багратуни  25 ноября, 11:10
    Я эту статью не для потверждения моей мысли послал, а просто, как очень интересную и важную статью.
    ОтветитьНравится
  • Антон Брандт  22 ноября, 02:44
    Вот интересно, Его Святейшество, Великая Астаха Всех Времен и Народов снизойдет до нас недостойных и поведает великую истину касаемую эволюции, открытую им в подвале Болгарии еще 30 лет назад?
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:10
    я думаю что нет, мы ведь недостойны
    ОтветитьНравится
  •   23 ноября, 21:41
    Без эволюции ни одна сложная система не может появиться на свете.
    Проследить эволюцию живых существ не просто.

    Зато можно проследить эволюцию любых предметов или систем, созданных человеком. Ничто из произведенного людьми не миновало эволюции.

    Например, самолет. Эволюционировал на протяжении 100 лет. Каждый раз небольшими шажками, которые можно назвать мутациями. Потому что ни один инженер или изобретатель, заранее не может знать, принесет ли его изобретение пользу или нет.

    Компьютер, видеокамера, автомобиль, телефон, часы, — все эти вещи эволюционировали, а не были созданы в одночасье.

    Даже более простые вещи, такие как стол, вилка, зубная щетка и т.д. эволюционировали.

    Разница между эволюцией живых существ и эволюцией сделанных человеком предметов только в процессе мутаций и отбора. Вместо мутаций в ДНК — случайные догадки, которые приходят в голову изобретателям или инженерам. Вместо выживания в среде обитания — выживание на рынке.

    Представим себе древнегреческого философа, который попал в наше время. Увидев компьютеры, айфоны, автомобили и т.д. он, не имея возможности проследить их эволюцию, решит, что они божественного происхождения. Слишком они совершенны, — решит философ, — человек не мог их создать. А их и не создавал человек. Они сами создались с его помощью.

    Это иллюзия, что самолеты и автомобили созданы человеком. Они продукты эволюции, в которой учавствовал человек.

    Так же с биологическими видами. Когда не можешь проследить эволюцию, она кажется невозможной.

    ОтветитьНравится
  • Александр Вихров  24 ноября, 18:07
    Леoнид Герзoн, насчет эволюции техники, довольно странное суждение. Любому мало-мальски знакомому с изобретательством известно, что сначала появляется идея, а затем уже она воплощается в технике.
    Человек он творец по сути, то есть Бог. Причем тут ваши иллюзии? Может иллюзия то, что природа сама по себе эволюционирует?
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:16
    Если подразумевать слово человек=человечество, то иллюзии исчезают, просто закон эволюции и постоянного усложнения систем и тут работает. Но, я согласен что немного некорректно сравнивать эволюцию, где есть творец, от эволюции, где его нет.
    ОтветитьНравится
  •   25 ноября, 18:55
    Творение, так как оно описано в Библии, подразумевает создание сложных систем моментально, сразу, одним действием.

    Человек на такое совершенно не способен.

    Мог ли, например, даже такой умный человек, как Исак Ньютон или Леонардо Да Винчи, создать компьютер или видеокамеру?

    Ответ очевиден.

    Человек просто чрезвычайно гордое собой существо. Скажите, самолет был сотворен человеком? Или он все-таки эволюционировал?

    Идея не появляется из ничего. Идея — это маленькая мутация, которая основана на накопленном ранее материале. Идея возникновения Аёфона, очевидно, не могла прийти в голову Аристотелю, потому что не было накопленного материала. Точно также, как у динозавров не могла возникнуть мутация, приведшая бы к появлению у них разумной речи.

    Птичьи гнезда тоже эволюционируют. Но почему-то никому не приходит в голову назвать эту эволюцию творением, а птиц творцами гнезд.

    ОтветитьНравится
  •   25 ноября, 18:55
    Простите, кто конкретно творец эволюции компьютеров?
    ОтветитьНравится
  •   25 ноября, 18:58
    1). Человек != человечество.

    2). Человечество не имеет централизованного органа мышления, который осознанно что-то создает. Поэтому человечество нельзя назвать творцом.

    Человек бывает творцом только очень простых, заранее ему известных вещей. Например, человек на заводе по заданной программе сотворяет некую деталь.

    ОтветитьНравится
  • Идея мобильного телефона, в современном понятии — как средство обмена различным контентом, была высказана Теслой более 100 лет назад. Не Аристотель, конечно, но фсётки)))
    ОтветитьНравится
  • у человечества очень много центров мышления, объединяющих несколько человек.
    фактически очень мало людей не думает за кого то. Даже у дворников есть дети и домашние животные...
    ОтветитьНравится
  • Александр Морозов.  28 ноября, 11:31
    >>Идея мобильного телефона, в современном понятии — как средство обмена различным контентом, была высказана Теслой

    Пруфлинк, пожалуйста. А то начинает казаться что Тесла изобрел вообще все на свете, от секса до ядерного реактора.

    ОтветитьНравится
  • ХА! Толку то от того линка, даже если найду :-)
    Нотариально заверенного с подписью автора всё равно ж не найду :-)
    А вообще речь шла об устройстве, которое, с помощью электричества конечно же, будет передавать звук и изображение, при этом устройство будет «как карманные часы».
    ОтветитьНравится
  • Тесле действительно приписывают многие небывалые вещи, но данному слуху я склонен верить. Всё таки кино/радио уже существовало.
    Да и компьютеризацию многое предсказано в литературе, в фантастике.
    Всё таки моё упоминание Теслы связано с идеей возникновения новых технологий...
    ОтветитьНравится
  •   28 ноября, 18:35
    Но создать мобильный телефон Тесла, увы, не смог...
    Без эволюции никак, даже Тесле
    ОтветитьНравится
  • Тем более «моментально»))) это и сейчас не могут)))
    Но представить — вполне.
    а жил бы он сейчас, мог бы и чо похлеще айфона выдумать)))

    ЗЫ это схожу с путаницей об информации и её носителе.

    ОтветитьНравится
  •   29 ноября, 15:25
    Сейчас могут — Айфоны штампуют моментально на заводах по тысяче штук в минуту.

    Если бы Тесла жил сейчас, то это уже был бы не Тесла, а другой человек, получивший образование в наше время.

    Путаницы никакой нет. Разговор шел о сравнении эволюций биологической и технологической. Носители информации в них разные, а процессы схожи. Эволюция в обоих случаях движима маленькими, случайными изменениями и последующим отбором.

    То, что у Теслы 100 лет назад была какая-то идея никакого отношения к развитию технологий не имеет. Представлять о технологиях будущего можно что угодно, но реально предвидеть мало что можно. Кстати, писатели фантасты совсем не далекого прошлого не могли угадать вещи, появившиеся всего через 30 лет. Например, в книгах Лема (Солярис, Возвращение со звезд) герои далекого будущего не имеют мобильных телефонов и каждый раз, чтобы позвонить, разыскивают стационарный телефон.

    ОтветитьНравится
  • Да вы фрик :-)
    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 05:27
    «Эволюция в обоих случаях движима маленькими, случайными изменениями и последующим отбором.»

    _Где биллионы промежуточных видов в качественном отношении? Их нет

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 05:29
    ««Эволюция в обоих случаях движима маленькими, случайными изменениями и последующим отбором.»

    _Где биллионы промежуточных видов в качественном отношении? Их нет»

    Я кажется вас не так понял. Вы верите в Творца или нет?

    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 05:30
    «««Эволюция в обоих случаях движима маленькими, случайными изменениями и последующим отбором.»
    _Где биллионы промежуточных видов в качественном отношении? Их нет»
    Я кажется вас не так понял. Вы верите в Творца или нет?»

    _ Не так выразился, вы верите, что из веществ земли само по себе случайно возникнуть жизнь?

    ОтветитьНравится
  • Антон Брандт  23 ноября, 22:11
    Антон Брандт 21 ноября, 16:50
    Откуда эта циферь, Вихров?
    Без серьезного источника это пшик.

    Александр Вихров 22 ноября, 06:56
    Антон Брандт, все цифры из научных и научно-популярных источников, далеко не религиозных.

    Перефразирую, в доступную вам форму — линки в студию!

    ОтветитьНравится
  • Сергей Асташкин  24 ноября, 07:46
    -- Логика автора просто детская.. учиться надо.. почитать про РНК зарождение (РНК жизнь), про ДНК, про цитологию, генетику.. задача «исследования» поставлена неверно, точнее — она не поставлена вообще, размазал рассуждения .. и .. ничего не родил.. Ни предмета-объекта «обмысливания» не предложил, ни инструмента научного исследования, ни целей не обозначил .. просто слова, где есть слово ДНК .. и всё ? вы посмотрите как пишутся методологические исследования.. Как работает ДНК и РНК — потому что они должны найти у вас, хотя бы, фактические свои функции и их эволюцию.. А у вас НИЧЕГО..
    ОтветитьНравится
  • Александр Вихров  24 ноября, 18:10
    Сережа, не нада здесь про РНК-фигню. Никакой РНК-жизни не зарегистрировано. Людей просто дурачат. Саморепликация не проходит даже теоретически. Слишком много химсоединений с 2-мя и 3-мя водородными связями.
    ОтветитьНравится
  • Сергей Асташкин  24 ноября, 21:41
    -- Вы пишите глупости, что вы можете знать о теории ,даже не прочитав о чём там речь... Вот ваши читатели, полуидиоты типа Антона ...
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:41
    Сергей, неужели вы опуститесь до Дубинянского — Лалетина в оскорблениях на нашем форуме, мы же тут все интеллигенты(или пытаемся ими быть). Не согласны, так поясните в чём, и если уж вы такой спец в этом разделе, расскажите где получили образование, и сколько у вас публикаций например, есть ли работы, рецензии. А так мы тут все полусамоучки по некоторым дисциплинам, которые не изучали в вузах. Если вы знаете больше информации, чем кто-либо другой в ветке, так расскажите, или не мешайте рассказывать другим, если они считают, что тоже чего то знают.
    Насколько я слышал, рнк жизнь это всего лишь гипотеза, нельзя ей что то доказывать.
    ОтветитьНравится
  • Сергей Асташкин  26 ноября, 20:40
    -- Зачем слышать? читайте : en.wikipedia.org/wiki/RNA_world_hypothesis . Коротко: все остальные теории(гипотезы) — имеют временную невозможность, РНК-Зарождение — это уже не гипотеза, она в принципе решает главный основной парадокс «времени» самозарождения — менее 50млн лет?! и появятся первые «смысловые» микрорнк длинной более 60 Нуклеиновых оснований (НО).! Когда сейчас установлено.что уже более 24 НО несут «смысловые нагрузки, могут иметь биохимические свойства — катализаторов и участвовать в „редактировании“ микроРНК. Этот первичный пакет НОВЫХ следующих из простого удлиннения полимерных цепей про РНК — биохимических свойств (т.е.. свойств ,присущих ТОЛЬКО пептидам и живым системам) и есть то доказательство, которое на этапе рождения РНК-МОДЕЛИ самозарождения Жизни — делает уже легко объяснимыми последующие этапы развития Жизни. Причём , с самой „необъяснимой“ её стороны для других гипотез: появление информационных свойств в „химии Жизни“ — они ,наоборот» из информационной плавно «перетекли» в биохимицеские.. И исчезли самые неприятные трудности бековых и других моделей..
    ОтветитьНравится
  • Владимир Королёв  26 ноября, 23:41
    в самом названии статьи слово гипотеза какбэ намекает что это гипотеза.
    ОтветитьНравится
  • Антон Брандт  24 ноября, 14:04
    Я знал!
    Я верил!
    Молились и воздалось за веру!
    Великая Астаха с нами!!!
    ОтветитьНравится
  • Сергей Асташкин  24 ноября, 21:44
    -- И я не с вами придурок. а с Мембраной, в которой уже 6 лет.. таких уродов как вы — тут было редео.. может 1-2 за всю историю.. я бы вас забанил.. такие не лечатся..
    ОтветитьНравится
  • Антон Брандт  25 ноября, 03:33
    Фу, как грубо.
    Расслабьтесь, ато кака выпадет.
    Пейте пустырник и больше спите, ато нервы у вас совсем ни к черту)
    ОтветитьНравится
  • Александр Вихров  25 ноября, 07:26
    Представьте, а мне этого больного 6 лет терпеть пришлось:)))
    ОтветитьНравится
  • Александр Морозов.  25 ноября, 08:02
    Похоже Асташкин и Ко тут неотъемлемая часть субкультуры ;))
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 09:53
    -- Представьте, если б тут были только вы ? кто бы сюда после этого вообще зашёл ?
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 10:14
    -- Зато теперь вы окружены подобными вам..
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:50
    Если сильно расслабиться, то кака тоже может выпасть, необходимо соблюдать баланс, а это не всем удается))
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:52
    Иногда мне кажется, что скобочки в концах постов выдают людей с уравновешенной психикой, или это иллюзия?))
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:55
    или несерьезный человек, на которого нельзя положиться :-)
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:58
    заметьте, я не писал смайлики, я писал скобочки
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:58
    )))
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 12:39
    я тут передачу видела: там говорилось, что большинство мутаций происходит от попадания (они там говорили про РНК, которое потом преобразуется в ДНК) кода ретро-вирусов, и после, попадая внутрь клетки вставляется в цепь ДНК хозяина. Таким образом получается ДНК отличная от прежней.
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 12:57
    код ретровируса попадает в момент репликации? или в любой другой момент.
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 13:00
    вы мне по-русски объясните, я же не биолог
    ОтветитьНравится
  • Владимир Королёв  25 ноября, 14:14
    я кстати тоже не биолог, но я так понял что разница существенная, появляется ли мутация именно при репликации или в любое время вообще.
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 14:29
    глядя эту передачу, просто подумалось: вот когда от вируса внедряется часть кода в ДНК хозяина — по каким правилам этот кусов встраивается в определенный участок ДНК? Хаотично? или все же есть какая то закономерность — например: может влиять внешняя среда(?). Он (кусок кода от вируса) в зависимости от многих параметров (температура, повышенное содержание кислорода, углерода, др. хим элементов), может обогатиться, либо потерять пока встраивается в нужный участок ДНК хозяина.
    ОтветитьНравится
  • Ольга Добрая  25 ноября, 14:30
    может таким образом и происходит эволюция? :-)
    ОтветитьНравится
  • Александр Вихров  25 ноября, 16:47
    Ольга Фокина, во первых, это бывает крайне редко, во-вторых, они встраиваются в определенные слабые места, в-третьих, это мусор. Даже если этот ген экспрессируется, то это будет белок вируса, организму совершенно не нужный.
    ОтветитьНравится
  • Алексей Мыцик  25 ноября, 17:19
    Внимание вопрос ! Если я сьедаю сырую печень могучего воина, есть шанс улучшить свою генетическую линию? ( в смысле могучести).
    ОтветитьНравится
  • Poмaн Coлжeницын  25 ноября, 17:33
    http://www.popmech.ru/article/9957-ot-sueveriya-k-psihologii/
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 17:54
    -- Когда «работает» РНК вируса в нём часто используется т.н. обратная транскриптаза — и вот она уже может при ошибке и выживании ЕС (эмбриональной стволовой клетки) вставить в Геном клетки (в её ДНК) кусочки вируса или ещё чего рядом..
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 17:56
    -- Нет встраивание с участием обратной транскиптазы — будет немного целевым- т.е. не совсем случайно..
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 17:57
    -- Что вы тут несёте гражданин ? Вы свою остановку уже проехали..
    ОтветитьНравится
  • Сергей Асташкин  25 ноября, 17:58
    -- Нет.
    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 05:19
    Эти ретровирусы вполне могли быть вставлены инопланетянами в порядке эксперимента, они может не знали, что кто-то будет настолько туп, что припишет это идолу природе. В любом случае без машины времени не обойтись. Я это говорю не потому, что такая информация часто встречается от тех, кто якобы имел контакты с инопланетянами или знаком с документами тайных встреч с инопланетянами правительств (создание рас и т.п).
    ОтветитьНравится
  • Shamil Dzhanbolatov  29 декабря, 05:23
    «Эти ретровирусы вполне могли быть вставлены инопланетянами в порядке эксперимента, они может не знали, что кто-то будет настолько туп, что припишет это идолу природе. В любом случае без машины времени не обойтись. Я это говорю не потому, что такая информация часто встречается от тех, кто якобы имел контакты с инопланетянами или знаком с документами тайных встреч с инопланетянами правительств (создание рас и т.п).»

    _Но чтобы вызывать какие-то изменения, они эти вирусы должны конечно же иметь фрагменты человеческой ДНК, как это делают ныне в лабораториях, случайно «эволюционно» это невозможно, так как нет фактических доказательств самозарождения ДНК.

    ОтветитьНравится
  • Антон Брандт  26 ноября, 12:48
    Сергей Асташкин 25 ноября, 17:54

    Сергей Асташкин 25 ноября, 17:56

    Сергей Асташкин 25 ноября, 17:57

    Сергей Асташкин 25 ноября, 17:58

    Данный потокъ сознания защищен «Законом объ авторском праве» его копирование, полное или частичное, без разрешения автора является федеральным преступлением!

    ОтветитьНравится
  • Виктор Бутрий  29 ноября, 09:37
    Александр, типичная ошибка — ставить перед СТЭ вопросы биогенеза, которыми она не занимается. Вы сомневаетесь в биогенезе? Ну так и рассматривайте самую первую систему записи/хранения, которая существовала на заре биологической эволюции.

    А с Вашим подходом можно доказать что ни самолёта, ни автомобиль построить нельзя потому что (...подставить что-нибудь...).

    ОтветитьНравится
  • Сергей Иванов  26 декабря, 17:48
    «Чтобы проверить применимость СТЭ теоретически, необходимо ввести граничные условия.»
    Непонятно, как математически(=теоретически) СТЭ в принципе зависит от начальных условий? Если СТЭ суть процесс Маркова, то финальные вероятности не зависят от начального распределения в принципе. Являются лишь свойствами самой матрицы перехода, т.е. собственным вектором при собственном значении=1. Ошибка в том, что процесс считывания сам по себе нельзя считать детерминированным. Система не читает, она пробует.
    ОтветитьНравится
  • Shamil Dzhanbolatov  31 декабря, 00:46
    «Скорее всего, их ДНК уже навсегда утеряна, разложилась. Я не верю в то, что у нас когда-нибудь будет Парк юрского периода.»
    _Что не мешает эволюционистам уверенно, клятвенно, и главное НАУЧНО, считать только по внешним признакам, что археоптерикс — промежуточное звено (чуть ли не единственное при этом почему-то(!) между динозаврами и птицами. Возражения не принимаются и предаются анафеме как не научные, и, о ужас, псевдонаучные
    ОтветитьНравится